PRGDB00061552 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438156 (FJ842787)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL37 disease resistance protein gene, complete cds.

DNA Sequence

ATGGAGTCTTCGTCTCCTTCTCGAAATTGGAGATTCAACGTCTTCCCGAGCTTCTGCGGTGAAGATCTCCGCAAAAACTTCCTCAGCCATTTCCTGAAGGAGTTGCAAAGGAAAGGAATCACAACTTTCATCGATCATGAGATCAAGAGGAGCAAAGCTATCGGCCCTGAGCTCGTGGCAGCGATCAGAGGATCAAGGATGGCAGTCATCTTGCTCTCGAAGAACTATGCATCTTCGACGTGGTGTTTGAACGAACTGCTCGAAATCATGAGCTGTAAAGAAGAGATCGGCCAAACAGTGATGCCGGTTTTCTACGAAGTCGATCCATCTGACGTCAGAAAGCAGGCCGGGGATTTTGGAAACATCTTTGAAGAAACTTGTTTGGGGAAGTCGGAAGAAGTGAGGCAGAGATGGTCACGGGCTCTGACGGACCTCGCGAATCTAGCCGGAGTGGATTCTCGCCTCTGGAACAATGAAGCTGATATGATTGAGAAACTTGCGTTGGATATCTCTAGTGCATTAAACGTTACACCTTCAAGGGACTTTGATGATCTCGTTGGAATAGAAGCTCATATCAAAAATCTGAAGCCATTGTTATCTCTAGAGTCTAGTGAAGTGAGGATTGTAGGTGTTTGGGGTCCTGCGGGAATTGGGAAGACAACCATTGCAAGAGCTCTATACACTCGACTGTCTCCTATTTTCCAGCATAGTGCATTCATGGGGAACATTAAGGAAACATATAGGAGAATCAGCCTCGATGATTACGGTTCGAAGTTGCATCTGCAAGAAGAGTTTTTGTCTAAGCTTATCAACCATAAAGATGTGAAGATACCTCACTCAGGTGTGGTAAGAGAAAGGTTGAAGGACAAGAGAGTCTTTGTTGTTCTTGATGATGTTGATGAACTGGAGCAACTCATTGCCTTGGCAAAGGAGCCTCGATGGTTTGGTTCTGGAAGTAGGATTGTAGTGACCACACAAGATAGACAGCTTCTGAAAGCACATGGTATCGACCTTGTATACAAGGTGGAACTTCCGTCTAGACTCGAAGCTCTTGAGATCTTCTGTCAATCTGCTTTTGGACAAAAGCATCCTCCTTGTGTCGGTATCAGGGAGCTCGCGCTACAAGTGACTCATCTTGCTGGATATCTTCCTTTGGGTTTAACCGTTTTGGGCTCCTACTTGCGAGGGTTTTCTAAAGAAGAGTGGGAATATGCAATACCAAGACTTAACACAAGTCTTGATGGTAAAATTGANAAGACTTTGAGATTCAGCTATGATGCCTTGCATAGTAAAGATAAATCCATATTTCTTCACATTGCTTGTTTGTTCAATGGTAAGAACGTCNAGGATGTGAAGATGTTGCTTGAGAATAGTAACTTGGACGTTGACCACGGACTTAAAGCCTTGGCTGATAAATCTCTTATAGATACTCATTGGGGACGCATACATATGCACTCTCTGTTACAAAAAATGGGTAGAGAGATCGTCTGTCAACAGTCTGTTCACGAGCCTGGAAAACGTCAGTTCTTGGTTGATGCTGAGGAGATTAGGGATGTACTTGCCTGCAAATCCGGTACAGCAACTGTCTTAGGCATATCATTCGATGCATCGAAAATCAATGGAGAGTTATCCATAAGTAAGAAAGCCTTTAAAGGAATGCATAATCTCCAGTTCTTGGAGATATATAAGAAATGGAATGGTAGATCCAGACTAAATCTGCCACAGGGTCTAAACTATTTACCCCACAAACTTAGACTGCTACACTGGGACTCGTTTCCTATGAGATCTTTGCCTTCCAAGTTCTCTGCAGAGTTCCTTGTGGAACTCAGAATGAGATTTAGCAAGCTTGAGAAACTCTGGGAAGGGATCATACCACTTAGGAGTCTCAAAGTGATGGATGTGAGTTACTCCAGAAAGCTCAAAGAGATTCCTAATCTCTCAAATGCCACAAACCTTAAGAAATTTTCAGCAGATGGTTGTGAAAGCCTCAGTGCATTCCCACATGTCCCTAACTGCATCGAGGAGCTTGAACTAAGCTACACAGGAATAATAGAAGTTCCTCCATGGATCAAGAATCTCTGTGGGCTGCAGAGAGTCTGTATGACGCAATGCTCGAAACTAACCAATATCTCTATGAACGTTTCAAAGCTCGAGAACCTTGAAGAAGTGGATTTCTCAGGCAGTGTGGATGGTATACTGTTTACTGCAATAGTTAGTTGGCTCTCTGGTGTCAAGAAAAGGCTGACGATAAAGGCTAATAATATTGAAGAAATGTTACCAAAATGTCTACCGAGAAAGGCATATACTTCTCCAGTTTTACTGGATTTGAGTGGTAACGAAGATATCAAAACTATTCCAGACTGCATCAAACATTTTTCTCAACTTCATAAGCTTGACGTTGGAAAATGCAGAAAGCTTACATCACTTCCACAGCTTCCAGAATCACTTTCAGAGCTAAATGCACAAGAGTGTGAGTCTCTTGAGAGAATACATGGTTCGTTTCACAATCCAGACATCTGTCTCAATTTTGCAAACTGCTTGAAACTCAACAGAGAAGCAAGAGAGCTCATATGTGCATCACCTAGCAGATACACCATCTTACCTGGTGAAGAACAGCCTGGAATGTTTAAAGACCAAACTTCAGGAGATCTGTTAAAGGTTGTGCATATGATTCAGAGACCCTTTCCTCGATTCCTGAGATATAAGGCTTGCATTAGGCTTCTTGCTCGGTCAGCTGTCTATGACGATGACTCTGGTGGTATTGCTCGTGTAGCTTGTTGCATAAGGCGCATATGCGATGGCAGTGTTGTGAGAGATGAATCTCTAGAGTTACACATTCCTGTACTCGTGAACGATCATCTCTTTACATTGGGAGGTTCTTTGATCCTAAACAAAGGCAATGAACCTGAAGTAGATGCAACGTTCAGCGAGTTTTTGTTCGAGTTCAAGGCCAACATAAAGATGGAGATTATAGGATGTCAATTTACAGTTCTTGGGGGCAAAAGGGACTATGATACATATTCTAGATGGAATGAAGAAGTTTCTAGCCAGCAAGATAAAAGGATAAGGCATGAAACTGAGGAACAAAGATAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MESSSPSRNWRFNVFPSFCGEDLRKNFLSHFLKELQRKGITTFIDHEIKRSKAIGPELVAAIRGSRMAVILLSKNYASSTWCLNELLEIMSCKEEIGQTVMPVFYEVDPSDVRKQAGDFGNIFEETCLGKSEEVRQRWSRALTDLANLAGVDSRLWNNEADMIEKLALDISSALNVTPSRDFDDLVGIEAHIKNLKPLLSLESSEVRIVGVWGPAGIGKTTIARALYTRLSPIFQHSAFMGNIKETYRRISLDDYGSKLHLQEEFLSKLINHKDVKIPHSGVVRERLKDKRVFVVLDDVDELEQLIALAKEPRWFGSGSRIVVTTQDRQLLKAHGIDLVYKVELPSRLEALEIFCQSAFGQKHPPCVGIRELALQVTHLAGYLPLGLTVLGSYLRGFSKEEWEYAIPRLNTSLDGKIXKTLRFSYDALHSKDKSIFLHIACLFNGKNVXDVKMLLENSNLDVDHGLKALADKSLIDTHWGRIHMHSLLQKMGREIVCQQSVHEPGKRQFLVDAEEIRDVLACKSGTATVLGISFDASKINGELSISKKAFKGMHNLQFLEIYKKWNGRSRLNLPQGLNYLPHKLRLLHWDSFPMRSLPSKFSAEFLVELRMRFSKLEKLWEGIIPLRSLKVMDVSYSRKLKEIPNLSNATNLKKFSADGCESLSAFPHVPNCIEELELSYTGIIEVPPWIKNLCGLQRVCMTQCSKLTNISMNVSKLENLEEVDFSGSVDGILFTAIVSWLSGVKKRLTIKANNIEEMLPKCLPRKAYTSPVLLDLSGNEDIKTIPDCIKHFSQLHKLDVGKCRKLTSLPQLPESLSELNAQECESLERIHGSFHNPDICLNFANCLKLNREARELICASPSRYTILPGEEQPGMFKDQTSGDLLKVVHMIQRPFPRFLRYKACIRLLARSAVYDDDSGGIARVACCIRRICDGSVVRDESLELHIPVLVNDHLFTLGGSLILNKGNEPEVDATFSEFLFEFKANIKMEIIGCQFTVLGGKRDYDTYSRWNEEVSSQQDKRIRHETEEQR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-151 TIR
Toll-Interleukin receptor

MESSSPSRNWRFNVFPSFCGEDLRKNFLSHFLKELQRKGITTFIDHEIKRSKAIGPELVAAIRGSRMAVILLSKNYASSTWCLNELLEIMSCKEEIGQTVMPVFYEVDPSDVRKQAGDFGNIFEETCLGKSEEVRQRWSRALTDLANLAGV

Gene3D: G3DSA:3.40.50.10140
8-147 G3DSA:3.40.50.10140

RNWRFNVFPSFCGEDLRKNFLSHFLKELQRKGITTFIDHEIKRSKAIGPELVAAIRGSRMAVILLSKNYASSTWCLNELLEIMSCKEEIGQTVMPVFYEVDPSDVRKQAGDFGNIFEETCLGKSEEVRQRWSRALTDLAN

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll-Interleukin receptor

WRFNVFPSFCGEDLRKNFLSHFLKELQRKGITTFIDHEIKRSKAIGPELVAAIRGSRMAVILLSKNYASSTWCLNELLEIMSCKEEIGQTVMPVFYEVDPSDVRKQAGDFGNIFEETCLGKSEEVRQRWSRALTDLANL

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll-Interleukin receptor

RFNVFPSFCGEDLRKNFLSHFLKELQRKGITTFIDHEIKRSKAIGPELVAAIRGSRMAVILLSKNYASSTWCLNELLEIMSCKEEIGQTVMPVFYEVDPSDVRKQAGDFGNIFEETCLGKSEEVRQRWSRALTDLANL

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll-Interleukin receptor

VFPSFCGEDLRKNFLSHFLKELQRKGITTFIDHEIKRSKAIGPELVAAIRGSRMAVILLSKNYASSTWCLNELLEIMSCKEEIGQTVMPVFYEVDPSDVRKQAGDFGNIFEETCLGKSEEVRQRWSRALT

HMMPanther: PTHR11017:SF20
34-883 PTHR11017:SF20,SUBFAMILY NOT NAMED

ELQRKGITTFIDHEIKRSKAIGPELVAAIRGSRMAVILLSKNYASSTWCLNELLEIMSCKEEIGQTVMPVFYEVDPSDVRKQAGDFGNIFEETCLGKSEEVRQRWSRALTDLANLAGVDSRLWNNEADMIEKLALDISSALNVTPSRDFDDLVGIEAHIKNLKPLLSLESSEVRIVGVWGPAGIGKTTIARALYTRLSPIFQHSAFMGNIKETYRRISLDDYGSKLHLQEEFLSKLINHKDVKIPHSGVVRERLKDKRVFVVLDDVDELEQLIALAKEPRWFGSGSRIVVTTQDRQLLKAHGIDLVYKVELPSRLEALEIFCQSAFGQKHPPCVGIRELALQVTHLAGYLPLGLTVLGSYLRGFSKEEWEYAIPRLNTSLDGKIXKTLRFSYDALHSKDKSIFLHIACLFNGKNVXDVKMLLENSNLDVDHGLKALADKSLIDTHWGRIHMHSLLQKMGREIVCQQSVHEPGKRQFLVDAEEIRDVLACKSGTATVLGISFDASKINGELSISKKAFKGMHNLQFLEIYKKWNGRSRLNLPQGLNYLPHKLRLLHWDSFPMRSLPSKFSAEFLVELRMRFSKLEKLWEGIIPLRSLKVMDVSYSRKLKEIPNLSNATNLKKFSADGCESLSAFPHVPNCIEELELSYTGIIEVPPWIKNLCGLQRVCMTQCSKLTNISMNVSKLENLEEVDFSGSVDGILFTAIVSWLSGVKKRLTIKANNIEEMLPKCLPRKAYTSPVLLDLSGNEDIKTIPDCIKHFSQLHKLDVGKCRKLTSLPQLPESLSELNAQECESLERIHGSFHNPDICLNFANCLKLNREARELICASPSRYTILPGEEQPGMFKDQTSGD

HMMPanther: PTHR11017
34-883 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELQRKGITTFIDHEIKRSKAIGPELVAAIRGSRMAVILLSKNYASSTWCLNELLEIMSCKEEIGQTVMPVFYEVDPSDVRKQAGDFGNIFEETCLGKSEEVRQRWSRALTDLANLAGVDSRLWNNEADMIEKLALDISSALNVTPSRDFDDLVGIEAHIKNLKPLLSLESSEVRIVGVWGPAGIGKTTIARALYTRLSPIFQHSAFMGNIKETYRRISLDDYGSKLHLQEEFLSKLINHKDVKIPHSGVVRERLKDKRVFVVLDDVDELEQLIALAKEPRWFGSGSRIVVTTQDRQLLKAHGIDLVYKVELPSRLEALEIFCQSAFGQKHPPCVGIRELALQVTHLAGYLPLGLTVLGSYLRGFSKEEWEYAIPRLNTSLDGKIXKTLRFSYDALHSKDKSIFLHIACLFNGKNVXDVKMLLENSNLDVDHGLKALADKSLIDTHWGRIHMHSLLQKMGREIVCQQSVHEPGKRQFLVDAEEIRDVLACKSGTATVLGISFDASKINGELSISKKAFKGMHNLQFLEIYKKWNGRSRLNLPQGLNYLPHKLRLLHWDSFPMRSLPSKFSAEFLVELRMRFSKLEKLWEGIIPLRSLKVMDVSYSRKLKEIPNLSNATNLKKFSADGCESLSAFPHVPNCIEELELSYTGIIEVPPWIKNLCGLQRVCMTQCSKLTNISMNVSKLENLEEVDFSGSVDGILFTAIVSWLSGVKKRLTIKANNIEEMLPKCLPRKAYTSPVLLDLSGNEDIKTIPDCIKHFSQLHKLDVGKCRKLTSLPQLPESLSELNAQECESLERIHGSFHNPDICLNFANCLKLNREARELICASPSRYTILPGEEQPGMFKDQTSGD

superfamily: SSF52540
65-437 SSF52540

SRMAVILLSKNYASSTWCLNELLEIMSCKEEIGQTVMPVFYEVDPSDVRKQAGDFGNIFEETCLGKSEEVRQRWSRALTDLANLAGVDSRLWNNEADMIEKLALDISSALNVTPSRDFDDLVGIEAHIKNLKPLLSLESSEVRIVGVWGPAGIGKTTIARALYTRLSPIFQHSAFMGNIKETYRRISLDDYGSKLHLQEEFLSKLINHKDVKIPHSGVVRERLKDKRVFVVLDDVDELEQLIALAKEPRWFGSGSRIVVTTQDRQLLKAHGIDLVYKVELPSRLEALEIFCQSAFGQKHPPCVGIRELALQVTHLAGYLPLGLTVLGSYLRGFSKEEWEYAIPRLNTSLDGKIXKTLRFSYDALHSKDKSIFL

Gene3D: G3DSA:3.40.50.300
179-304 G3DSA:3.40.50.300

SRDFDDLVGIEAHIKNLKPLLSLESSEVRIVGVWGPAGIGKTTIARALYTRLSPIFQHSAFMGNIKETYRRISLDDYGSKLHLQEEFLSKLINHKDVKIPHSGVVRERLKDKRVFVVLDDVDELEQ

HMMPfam: PF00931
IPR002182
189-452 NB-ARC,NBS
NB-ARC

EAHIKNLKPLLSLESSEVRIVGVWGPAGIGKTTIARALYTRLSPIFQHSAFMGNIKETYRRISLDDYGSKLHLQEEFLSKLINHKDVKIPHSGVVRERLKDKRVFVVLDDVDELEQLIALAKEPRWFGSGSRIVVTTQDRQLLKAHGIDLVYKVELPSRLEALEIFCQSAFGQKHPPCVGIRELALQVTHLAGYLPLGLTVLGSYLRGFSKEEWEYAIPRLNTSLDGKIXKTLRFSYDALHSKDKSIFLHIACLFNGKNVXDVK

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

IVGVWGPAGIGKTTIA

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

RLKDKRVFVVLDDVD

Gene3D: G3DSA:3.40.50.300
321-354 G3DSA:3.40.50.300

IVVTTQDRQLLKAHGIDLVYKVELPSRLEALEIF

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

AGYLPLGLTVLGSYL

superfamily: SSF52058
495-889 SSF52058,LRR

IVCQQSVHEPGKRQFLVDAEEIRDVLACKSGTATVLGISFDASKINGELSISKKAFKGMHNLQFLEIYKKWNGRSRLNLPQGLNYLPHKLRLLHWDSFPMRSLPSKFSAEFLVELRMRFSKLEKLWEGIIPLRSLKVMDVSYSRKLKEIPNLSNATNLKKFSADGCESLSAFPHVPNCIEELELSYTGIIEVPPWIKNLCGLQRVCMTQCSKLTNISMNVSKLENLEEVDFSGSVDGILFTAIVSWLSGVKKRLTIKANNIEEMLPKCLPRKAYTSPVLLDLSGNEDIKTIPDCIKHFSQLHKLDVGKCRKLTSLPQLPESLSELNAQECESLERIHGSFHNPDICLNFANCLKLNREARELICASPSRYTILPGEEQPGMFKDQTSGDLLKVVH

Gene3D: G3DSA:3.80.10.10
544-831 G3DSA:3.80.10.10

SISKKAFKGMHNLQFLEIYKKWNGRSRLNLPQGLNYLPHKLRLLHWDSFPMRSLPSKFSAEFLVELRMRFSKLEKLWEGIIPLRSLKVMDVSYSRKLKEIPNLSNATNLKKFSADGCESLSAFPHVPNCIEELELSYTGIIEVPPWIKNLCGLQRVCMTQCSKLTNISMNVSKLENLEEVDFSGSVDGILFTAIVSWLSGVKKRLTIKANNIEEMLPKCLPRKAYTSPVLLDLSGNEDIKTIPDCIKHFSQLHKLDVGKCRKLTSLPQLPESLSELNAQECESLERIH

HMMPfam: PF07725
IPR011713
605-623 LRR_3
Leucine-rich repeat 3

FLVELRMRFSKLEKLWEGI

FPrintScan: PR00364
IPR000767
624-640 DISEASERSIST
Disease resistance protein

IPLRSLKVMDVSYSRKL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox