PRGDB00061557 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438146 (FJ842782)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL35 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTTCCTCGCCTCGCACATGGAGATACCGCGTCTTCACTAGCTTCCACGGACCCGACGTCCGCAAAACCTTTCTCAGTCATTTACGCAAACAGTTTGCCTGCAATGGGATTTCGATGTTCAATGATCAAGCGATCGAGAGAAGCCACACCATCGCCCCTGCTCTCACGCAAGCGATCAGAGAATCGAGGATCTCCATCGTGGTGTTAACGAAGAACTATGCTTCTTCCAGCTGGTGTTTGGATGAGCTTTTGGAGATTCTGAAATGCAAGGAAGAGATGGGTCAGATAGTGATGACGATCTTCTACGGAGTAGATCCTTCTCATGTTCGGAAACAAACCGGAGATTTCGGGAAAGTCTTAAAGAAAACGTGTTCTGGTAAAACAGAGGAAGAGAAGCAAAGATGGAGTCAAGCTTTGACCGATGTGGGAAACATAGCCGGGGAACACTTCCTCAACTGGGACAAGGAATCGGAGATGATTGAAAAGATTGCTAGAGATGTCTCAAACAAGCTAAATGCTACAGTCTCTAGGGATTTTGAAGACATGGTTGGTATTGAAGCACACTTGGATAAGATGCAATCTTTGTTACATTCAGATGAGGATGGAGCTATGATTGTTGGAATCTGTGGCCCTGCTGGCATTGGTAAGACTACCATTGCCAGGGCTTTACATAGTCGGCTCTCTAGCGGTTTCCAGCTTACTTGTTTTATGGAGAATCTTAGAGGAAGCTGTAACAGTGGTGGTCTTGATGAGTATGGATTGAAGCTGCGTTTACAAGAGCTACTTCTTTCCAAGATTTTTAACCAAAACGGTATGAGGATATACCATTTAGGTGCGATACCAGAAAGGTTATGCGACCTAAAAGTGCTTATCATTCTTGATGATGTGGACGATCTGCAGCAGCTTGAGGCTTTGGCTGATGAAACTAACTGGTTTGGTGATGGAAGCAGGATTATCGTAACCACGGAAGATCAAGAGCTTTTGGAGCAACATGGTATCACCAATATATACCATGTGGATCTTCCAACTGAAAAAGAGGCTCGTAAGATCTTTTGCAGATATGCTTTTAGACAGAGCTTACCACCATATGGTTATGAAAATCTTGCAGAAAGAGCAACAGAGCTGTGCGGCAATCTTCCTTTTGGTCTCCGTGTCATGGGTTCAATGTTACGGGGAAAGAAAGAAGACGACTGGGAAAGTATATTGTGCAGGCTAGAAAATAGCAATATACCAAAGATCGAAGCAGTACTTAGAGTTGGATACGACAGTTTACATGAGAAGGATCAAATTCTGTTTCACCTCATTGCAGTCTTCTTCAACTACGAAAACGATGGCCATGTGAAAACAATGCTAGCTGACAGTGGCTTGGATGTTAGACTCGGGTTGAAAACCCTCGCCTACAAATCTCTCATAAAAATATCTTCGGAAGGAGAAGTAGTGATGCACAAGTTACTACAGCAAGTGGGCAGACAAGCGATTCAAAGACAGGAGCCTTGGAAACGCCAAATTCTAATTGATACTGATGACATTCGAGATGTCCTTGAAAATGATTCTGGTAGTAGAAGCTTGATGGGGATATCTTTTGATATGTCTACAATCAAAGACGACATGGATATTAGCGCAAGAGTTTTTAAAAGTATGCGTACTCTTCGATTCCTCAGGGTCTACAACACGAGATGTGATACAAATGTTAGAGTGCATTTACCCGAGGACATGGAGTTTCCACCTCGTCTGAAGTTATTACACTGGGAGGTATATCCGAGGAAGTGTCTTCCTCGTACATTTTGTCCCGAACATCTTGTGGAACTACACTTGACAGATACCCAGCTTGAGCAATTGTGGGAAGGAACCCAGCCCCTCACAAGTCTCAAGAAGATGGTTTTGGTTTCGTGCTTGTGTCTAAAGGAACTCCCGGATCTAGCAAATGCTACAAATCTCGAAATATTGGATGTGTGTGGATGCCAGAGTTTGGTAGAGATTCATTCCTCTGTTGGAAATCTTCATAGACTGCAGAGTTTGGATATGATTTTCTGTAAAAAGCTACAGGTTGTTCCAACTCTCTTCAACTTGACATCTCTTGAATCACTCGTGATAATGGGATCCTACCAAATGAGGGAACTTCCAGATATTTCCACGACCATCAGAGAACTTTCAATCCCAGAAACAATGTTAGAAGAATTTCTTGAATCAACTAGACTCTGGTCTCATCTTCAGTGTCTCGAGATATTTGGCTGTGCCATTACACATCAGTTTATGGCACATCCATCTCAGAGAAATTTGATGGTAATGCGAAGTGTCACGGGTATTGAGAGAATTCCAGACTGTATCAAATGTCTTCATGGGTTAAAAGAGCTAAGTATATATGGCTGTCCAAAACTTGCATCACTCCCAGAGCTTCCTCGGTCGCTCACAACACTAACAGTATACAAATGTCCTTCACTGGAGACACTAGAACCTTTCCCTTTTGGCGCCCGGATTGAGGATCTCTCTTTCCTCGATTGCTTTAGATTGGGTCGAAAAGCAAGGCGACTAATTACCCAACAATCATCACGGGTATGCCTACCTGGAAGAAATGTACCTGCAGAGTTCCATCACCGGGCTATAGGAAATTTCGTGGCCATATGCTCAAATGCCTACCGATTTAAGATTTGTGCCGTGATTTCCCCTAAACAGGTGATGGTGGAAGATCAAGTTATTGAATTACTGTGTCACATACTCATAAATGGTTGTCCCATGAAGAGCACCTTGAAAAACAAATTTGATGTCGAGATTACAATCCAATTAGAACATCTCATTATATTCCCCTCCACATTGCTTACGGTAGACCGACGGCCTGAGCAGTACAGCGAGATATTGTTTGAATTCAGCACCACATCCCAGGACATCGAAGTTATTGAATGTGGTGTTCAGATCTTGAGGGACAAAACCGGAAGCTGTGAATCTAATTCAGAACAACTATTGGAATTGGAATTGGAAGACGACCTTGACTACGATGCACCAAGAGTAGATACCATTAAGGATTTTGCTAAGTTTCTTCCTTCGCTTCTTATTTTCCTTTCGAGTTTGATTCCAAGTGTTCTTTTTTATAGCTTACTAAAGCAACACAGGCACAGAGTACACTTATATGAATCATGGCTTGTTGGAAGAACTAGACATCATCAGAAAGAGATGAAGTTTCCATCAAAAGAAGTCTCCACTGACCTTAGTGTACAGTCGTGTGAGGAATCGGAGATGATTGAAAAGATTGCTAGAGATGTCTCAAACAAGCTAAATTCTACAGTCTCTACGGATTTTGAAGACATGGTTGGTATTGAAGCCCACTTGGAGAAGATGCAGTCTTTGTTACATTTAGATGATGAGGGTGGAGCTATGTTTGTTGGAATCTGTGGTCCTGCTGGCATTGGTAAGACTACCATTGCCAGAGCTTTACATAGCAGGCTCTCTAGCGGTTTTCAGCATTCTTGTTTTATGGAGAATCTTAGGGGAAGCTGTTGTAACAGTGGTCTTGACGAGTATGGATTGAAGCTGCGTTTACAAGAGCTACTTCTTTCCAAGATTTTTAACCAAAACGGTATGAGGATATACCATTTAGGTGCGATACCAGAAAGGCTGTGTGACCAAAAAGTGCTTATTATTCTTGATGATGTGGATGATCTAAAGCAGCTTGAGGCTTTGGCTGATGAAACTAAATGGTTTGGTGATGGAAGCAGAGTTATCTTGATGCTCGAGCTTGATGCTCGTCAGATCTTCTGTAGGATTGCATTTAGACAGCTCTCAGCACCCCATGGATTTGAAAAACTTGTGGAAAGAGTAGTAAATCTTTGTAGCAACCTTCCTTTGGGTCTCCGTGTCATGGGTTCATCTTTACGCAGAAAGAAAGTAGATGACTGGGAAGCTATATTGCAGAGGCTAGAGAATAGCCTTAATCGAGATATCGAAGGAGTACTTAGAGTCGGCTACGACAATTTACATAAGGATGATCAGTTCTTATTTCAGCTCATTGCATGCTTCTTCAACTACCAAGACGATGATCGTGTGAAAGCAATGCTCGTTGATAGTAACTTGGATGTTAGACTCGGGTTAAAAACTCTCTCGTACAAATCTCTCATACAAATATCTGCAGAGGGAACTATAGTGATGCACAAGTTACTACAACAAGTGGGCAGAGAAGCGGTTCATTTACAGGAGCCTAGGAAACGCCAAATCCTAATAGATGCTCACCAGATTTGTGATGTCCTCGAAAATGACTATGATAGTGCAAGTGTGATGGGTATATCTTTTGATACATCCACAATCCCAAACGGAGTGTGTATAAGCGCACAAGCTTTTAGAACAATGCGTGATCTTCGGTTTCTCAGCATCTACGAGACAAGACGTGATCCAAATGTTAGAATGCATTTACCTGAGGACATGAGTTTTCCACCTCTTCTAAGGTTATTACACTGGGAGGTATATCCAGGAAAGTGTCTTCCTCATACTCTTAGGCCAGAACATCTTGTGGAACTCTGTTTTGTTAACAGCAAGCTCGAGCAGCTTTGGCAAGGAATCCAGCCTCTTACAAATCTCAAGAAGATGGATTTGTCCGGGTCTCTGAGTTTGAAGGAAGTCCCTGATCTCTCGAATGCTACACATCTGAAGAGATTAAATCTAACAGGTTGCTGGAGTTTGGTAGAGATTCCTTCCTCTATTGGAGATCTTCATAAACTAGAGGAGCTGGAGATTAATTTATGTATAAGTCTACAGGTTTTTCCGAGTCACCTCAACTTGGCATCTCTTGAAACACTAGAGATGGTAGGATGCTGGCAACTGAGAAAAATTCCATATGTTTCGACCAAATCCCTCGTAATCGGAGACACAATGCTAGAAGAGTTTCCTGAATCACTGTGCCTAGAAGCGAAGAGAGTAATTACACAGCAATCATTTAGAGCATACTTTCCAGGAAAAGAGATGCCTGCAGAGTTCGATGATCATCGATCATTTGGAAGTTCCTTGACCATCCGTCCCGCTGTCTGCAAGTTTAGGATTTGCCTGGTGCTTTCCCCTAAACCGGATATGGAAGAAGCTTATTTCAGATTACTGTTTTGCATACGCGTAAAAGGTTGTCCCAGTGACGAAGACATGCTTTGGTTAGATCTCCCTAAAATCCGAGGGGAACATCTTTTTATATTTCAAGCTGAGTTTGTTGAACATCACGAGGAGATGGTGTTCAAATTCAGCACCTCATCCCATGAAGTCGACGTTGCTGAATGTGGTGTCCAGGTTTTGACAGATGAATCTTGTTCAGAACAAGTGTCTGAAGACGGCGATGATGTTCTCTCTGATGATAAGAGCAATGGATGTGATGAACCCAGAATCTTATCCCTTCAGTCAAACGTCAGCACATGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSSSSPRTWRYRVFTSFHGPDVRKTFLSHLRKQFACNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEMGQIVMTIFYGVDPSHVRKQTGDFGKVLKKTCSGKTEEEKQRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATVSRDFEDMVGIEAHLDKMQSLLHSDEDGAMIVGICGPAGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDLKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLEQHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFHLIAVFFNYENDGHVKTMLADSGLDVRLGLKTLAYKSLIKISSEGEVVMHKLLQQVGRQAIQRQEPWKRQILIDTDDIRDVLENDSGSRSLMGISFDMSTIKDDMDISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFGARIEDLSFLDCFRLGRKARRLITQQSSRVCLPGRNVPAEFHHRAIGNFVAICSNAYRFKICAVISPKQVMVEDQVIELLCHILINGCPMKSTLKNKFDVEITIQLEHLIIFPSTLLTVDRRPEQYSEILFEFSTTSQDIEVIECGVQILRDKTGSCESNSEQLLELELEDDLDYDAPRVDTIKDFAKFLPSLLIFLSSLIPSVLFYSLLKQHRHRVHLYESWLVGRTRHHQKEMKFPSKEVSTDLSVQSCEESEMIEKIARDVSNKLNSTVSTDFEDMVGIEAHLEKMQSLLHLDDEGGAMFVGICGPAGIGKTTIARALHSRLSSGFQHSCFMENLRGSCCNSGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLKQLEALADETKWFGDGSRVILMLELDARQIFCRIAFRQLSAPHGFEKLVERVVNLCSNLPLGLRVMGSSLRRKKVDDWEAILQRLENSLNRDIEGVLRVGYDNLHKDDQFLFQLIACFFNYQDDDRVKAMLVDSNLDVRLGLKTLSYKSLIQISAEGTIVMHKLLQQVGREAVHLQEPRKRQILIDAHQICDVLENDYDSASVMGISFDTSTIPNGVCISAQAFRTMRDLRFLSIYETRRDPNVRMHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSKLEQLWQGIQPLTNLKKMDLSGSLSLKEVPDLSNATHLKRLNLTGCWSLVEIPSSIGDLHKLEELEINLCISLQVFPSHLNLASLETLEMVGCWQLRKIPYVSTKSLVIGDTMLEEFPESLCLEAKRVITQQSFRAYFPGKEMPAEFDDHRSFGSSLTIRPAVCKFRICLVLSPKPDMEEAYFRLLFCIRVKGCPSDEDMLWLDLPKIRGEHLFIFQAEFVEHHEEMVFKFSTSSHEVDVAECGVQVLTDESCSEQVSEDGDDVLSDDKSNGCDEPRILSLQSNVST

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-153 TIR
Toll-Interleukin receptor

ASSSSSSPRTWRYRVFTSFHGPDVRKTFLSHLRKQFACNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEMGQIVMTIFYGVDPSHVRKQTGDFGKVLKKTCSGKTEEEKQRWSQALTDVGNIAGE

Gene3D: G3DSA:3.40.50.10140
10-147 G3DSA:3.40.50.10140

RTWRYRVFTSFHGPDVRKTFLSHLRKQFACNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEMGQIVMTIFYGVDPSHVRKQTGDFGKVLKKTCSGKTEEEKQRWSQALTDV

ProfileScan: PS50104
IPR000157
12-150 TIR
Toll-Interleukin receptor

WRYRVFTSFHGPDVRKTFLSHLRKQFACNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEMGQIVMTIFYGVDPSHVRKQTGDFGKVLKKTCSGKTEEEKQRWSQALTDVGNI

HMMSmart: SM00255
IPR000157
13-150 TIR
Toll-Interleukin receptor

RYRVFTSFHGPDVRKTFLSHLRKQFACNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEMGQIVMTIFYGVDPSHVRKQTGDFGKVLKKTCSGKTEEEKQRWSQALTDVGNI

HMMPfam: PF01582
IPR000157
16-145 TIR
Toll-Interleukin receptor

VFTSFHGPDVRKTFLSHLRKQFACNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEMGQIVMTIFYGVDPSHVRKQTGDFGKVLKKTCSGKTEEEKQRWSQALT

HMMPanther: PTHR11017:SF20
36-1002 PTHR11017:SF20,SUBFAMILY NOT NAMED

QFACNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEMGQIVMTIFYGVDPSHVRKQTGDFGKVLKKTCSGKTEEEKQRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATVSRDFEDMVGIEAHLDKMQSLLHSDEDGAMIVGICGPAGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDLKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLEQHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFHLIAVFFNYENDGHVKTMLADSGLDVRLGLKTLAYKSLIKISSEGEVVMHKLLQQVGRQAIQRQEPWKRQILIDTDDIRDVLENDSGSRSLMGISFDMSTIKDDMDISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFGARIEDLSFLDCFRLGRKARRLITQQSSRVCLPGRNVPAEFHHRAIGNFVAICSNAYRFKICAVISPKQVMVEDQVIELLCHILINGCPMKSTLKNKFDVEITIQLEHLIIFPSTLLTVDRRPEQYSEILFEFSTTSQDIEVIECGVQILRDKTGSCESNSEQLLELELEDDLDY

HMMPanther: PTHR11017
36-1002 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFACNGISMFNDQAIERSHTIAPALTQAIRESRISIVVLTKNYASSSWCLDELLEILKCKEEMGQIVMTIFYGVDPSHVRKQTGDFGKVLKKTCSGKTEEEKQRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATVSRDFEDMVGIEAHLDKMQSLLHSDEDGAMIVGICGPAGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDLKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLEQHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFHLIAVFFNYENDGHVKTMLADSGLDVRLGLKTLAYKSLIKISSEGEVVMHKLLQQVGRQAIQRQEPWKRQILIDTDDIRDVLENDSGSRSLMGISFDMSTIKDDMDISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFGARIEDLSFLDCFRLGRKARRLITQQSSRVCLPGRNVPAEFHHRAIGNFVAICSNAYRFKICAVISPKQVMVEDQVIELLCHILINGCPMKSTLKNKFDVEITIQLEHLIIFPSTLLTVDRRPEQYSEILFEFSTTSQDIEVIECGVQILRDKTGSCESNSEQLLELELEDDLDY

superfamily: SSF52540
67-438 SSF52540

SRISIVVLTKNYASSSWCLDELLEILKCKEEMGQIVMTIFYGVDPSHVRKQTGDFGKVLKKTCSGKTEEEKQRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATVSRDFEDMVGIEAHLDKMQSLLHSDEDGAMIVGICGPAGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDLKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLEQHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFH

Gene3D: G3DSA:3.40.50.300
182-221 G3DSA:3.40.50.300

RDFEDMVGIEAHLDKMQSLLHSDEDGAMIVGICGPAGIGK

HMMPfam: PF00931
IPR002182
191-448 NB-ARC,NBS
NB-ARC

EAHLDKMQSLLHSDEDGAMIVGICGPAGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDLKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLEQHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGNLPFGLRVMGSMLRGKKEDDWESILCRLENSNIPKIEAVLRVGYDSLHEKDQILFHLIAVFFNYEN

HMMSmart: SM00382
IPR003593
207-348 AAA,NBS
ATPase, AAA+ type, core

GAMIVGICGPAGIGKTTIARALHSRLSSGFQLTCFMENLRGSCNSGGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDLKVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLEQHGITNIYHVDLPT

Gene3D: G3DSA:3.40.50.300
222-248 G3DSA:3.40.50.300

TTIARALHSRLSSGFQLTCFMENLRGS

Gene3D: G3DSA:3.40.50.300
293-383 G3DSA:3.40.50.300

KVLIILDDVDDLQQLEALADETNWFGDGSRIIVTTEDQELLEQHGITNIYHVDLPTEKEARKIFCRYAFRQSLPPYGYENLAERATELCGN

superfamily: SSF52058
494-844 SSF52058,LRR

GRQAIQRQEPWKRQILIDTDDIRDVLENDSGSRSLMGISFDMSTIKDDMDISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFGARIEDLSFLDCFRLGR

Gene3D: G3DSA:3.80.10.10
544-828 G3DSA:3.80.10.10

ISARVFKSMRTLRFLRVYNTRCDTNVRVHLPEDMEFPPRLKLLHWEVYPRKCLPRTFCPEHLVELHLTDTQLEQLWEGTQPLTSLKKMVLVSCLCLKELPDLANATNLEILDVCGCQSLVEIHSSVGNLHRLQSLDMIFCKKLQVVPTLFNLTSLESLVIMGSYQMRELPDISTTIRELSIPETMLEEFLESTRLWSHLQCLEIFGCAITHQFMAHPSQRNLMVMRSVTGIERIPDCIKCLHGLKELSIYGCPKLASLPELPRSLTTLTVYKCPSLETLEPFPFG

Gene3D: G3DSA:3.40.50.300
1075-1136 G3DSA:3.40.50.300

VQSCEESEMIEKIARDVSNKLNSTVSTDFEDMVGIEAHLEKMQSLLHLDDEGGAMFVGICGP

superfamily: SSF52540
1089-1317 SSF52540

RDVSNKLNSTVSTDFEDMVGIEAHLEKMQSLLHLDDEGGAMFVGICGPAGIGKTTIARALHSRLSSGFQHSCFMENLRGSCCNSGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLKQLEALADETKWFGDGSRVILMLELDARQIFCRIAFRQLSAPHGFEKLVERVVNLCSNLPLGLRVMGSSLRRKKVDDWEAILQRLENSLNRDI

HMMPfam: PF00931
IPR002182
1110-1245 NB-ARC,NBS
NB-ARC

EAHLEKMQSLLHLDDEGGAMFVGICGPAGIGKTTIARALHSRLSSGFQHSCFMENLRGSCCNSGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLKQLEALADETKWFGDGSRVIL

HMMSmart: SM00382
IPR003593
1127-1264 AAA,NBS
ATPase, AAA+ type, core

GAMFVGICGPAGIGKTTIARALHSRLSSGFQHSCFMENLRGSCCNSGLDEYGLKLRLQELLLSKIFNQNGMRIYHLGAIPERLCDQKVLIILDDVDDLKQLEALADETKWFGDGSRVILMLELDARQIFCRIAFRQLS

FPrintScan: PR00364
IPR000767
1130-1145 DISEASERSIST
Disease resistance protein

FVGICGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
1137-1166 G3DSA:3.40.50.300

AGIGKTTIARALHSRLSSGFQHSCFMENLR

Gene3D: G3DSA:3.40.50.300
1204-1227 G3DSA:3.40.50.300

AIPERLCDQKVLIILDDVDDLKQL

FPrintScan: PR00364
IPR000767
1208-1222 DISEASERSIST
Disease resistance protein

RLCDQKVLIILDDVD

Gene3D: G3DSA:3.40.50.300
1240-1241 G3DSA:3.40.50.300

GS

HMMPfam: PF00931
IPR002182
1251-1347 NB-ARC,NBS
NB-ARC

ARQIFCRIAFRQLSAPHGFEKLVERVVNLCSNLPLGLRVMGSSLRRKKVDDWEAILQRLENSLNRDIEGVLRVGYDNLHKDDQFLFQLIACFFNYQD

Gene3D: G3DSA:3.40.50.300
1275-1311 G3DSA:3.40.50.300

RVVNLCSNLPLGLRVMGSSLRRKKVDDWEAILQRLEN

FPrintScan: PR00364
IPR000767
1280-1294 DISEASERSIST
Disease resistance protein

CSNLPLGLRVMGSSL

superfamily: SSF46785
1315-1419 SSF46785

RDIEGVLRVGYDNLHKDDQFLFQLIACFFNYQDDDRVKAMLVDSNLDVRLGLKTLSYKSLIQISAEGTIVMHKLLQQVGREAVHLQEPRKRQILIDAHQICDVLE

superfamily: SSF52058
1431-1634 SSF52058,LRR

SFDTSTIPNGVCISAQAFRTMRDLRFLSIYETRRDPNVRMHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSKLEQLWQGIQPLTNLKKMDLSGSLSLKEVPDLSNATHLKRLNLTGCWSLVEIPSSIGDLHKLEELEINLCISLQVFPSHLNLASLETLEMVGCWQLRKIPYVSTKSLVIGDTMLEEFPESLC

Gene3D: G3DSA:3.80.10.10
1441-1620 G3DSA:3.80.10.10

VCISAQAFRTMRDLRFLSIYETRRDPNVRMHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSKLEQLWQGIQPLTNLKKMDLSGSLSLKEVPDLSNATHLKRLNLTGCWSLVEIPSSIGDLHKLEELEINLCISLQVFPSHLNLASLETLEMVGCWQLRKIPYVSTKSLV

FPrintScan: PR00364
IPR000767
1522-1538 DISEASERSIST
Disease resistance protein

QPLTNLKKMDLSGSLSL

HMMPfam: PF00560
IPR001611
1549-1570 LRR_1
Leucine-rich repeat

HLKRLNLTGCWSLVEIPSSIGD


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox