PRGDB00061564 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438132 (FJ842775)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTN6 disease resistance protein gene, complete cds.

DNA Sequence

ATGAAGTTCGATGTATTCCTCAGTTTCAGAGGAATCGACACCCGAAGAACTTTCGTTAGCCATCTTCTCCTTGCACTGTTTAAAAAGCAGTTCAAGACTTTCAGACAAGAAGAAGAGATGCCATGGAATCAACCAGCTTCCACTCAAGTGCTCGAGGCAATTGAAAACTCCAAAATAGCGATCGTGGTCATATCGAAGAACTACACTGCTTCAGTCTCGTGCCTCGACGAACTGGCGAAGATAGTCGAGTGTGAGGAGAAACAATCGCTGGTGATGATTCCAGTCCTACACGAGGTGGATCCTTCAGATGTTTTAGAGCAAGCACAGAATCTTGATGGAGATATCAACAACAACTGGGAGACGGTGGAGAGATGGAGAAAGGCACTGGCCAGTATGATTAAGACCTATCAACAACTATACTCTCATTGGGAGGATGGAGACTCAAGTGAGGATGGAGACACAGACGCTTTCATTATTTTTAGAGTTATGCTCCACGTTTCTAAACGTTTGAAACCACCCGAGAAAATGGCACAGACTATGTATTATTGTCACTGGATGATACCTGAAAAAACTGGATTTCTCACCAAGGGGATCATGCTTGTTAGAGATGTTTTCAGGAAGATAGCTGGGAGAATTATGTATGCAGAAAAGCTTATTAGTGTCGTCAACCCTAGTACGCCTGCAAGGAGCCCTGCGTACGTGCAAAAAGACAAGTATGTTACGGGCAACGAGTTGTCTCAATTGGCTCCATCTATTGATTTCGATAGCCTTGTTGGGATGGATCGGCAAATGAAAGCAGTGGACGCACTGCTGCTTAATATGGATTCCGAAGAAGACGGACTTGGAGAAATGGGCATTTGTGGTGAGGAAAGAGTTGGCAAAACAACACTTGCGAGATGTGTTTACCAAAAGGTCTCACCACAGTTTCAAGATCACTACTACTTTGAGTATCAAACCGCACACTCTTTTGGTTCAACCTGTTTGCTAGAGAAAATCGCAAGAGCTGGTCTATCGGCAAAAGTAGCTGTTAGACCGGGTGAAGAGTTAGAGAGATTCGATGAACTTGTGAATGCGAATCTTGGACATCGGAAGGTTTTGCTTATTGTAGATATCCATCTCTATGACACTGGCCAACTCGAAAATATCAGAAACATTGCTCGTCGGTTTGGTCCAGGGAGTAGACTGATATACGTCACCCAGTCCAATCGTGTGCTACTCAAGTGTGGAGTCAAACACCTCTACAAAGTTGAGACTCTAAGATATGATGAAGCTCTTCAGCTCTTTTCACAATTTGCCTTCAAACAGGAACACGTCCCTAGGGAGTACTTCCGGCTCTCCATTCGTGCTGTCCTGATTACAGGTCGTATTCCACTGACCCTAAAAGTATTCGGCTCCTTCCTACGCGGGAAAACCGTCAGTGAATGGGAATCCGAGCTATGTAGACTTGAAGCATCGCAGGATAACTGCGTTGCAAAAATTGTGCATCGTTGTTTTATGGTCACTACTTATGAGTTCTTGAAGCCGCTTTCGTCCCATGACAGGCAGGCCTTACGGAGAATCCGTAAGTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MKFDVFLSFRGIDTRRTFVSHLLLALFKKQFKTFRQEEEMPWNQPASTQVLEAIENSKIAIVVISKNYTASVSCLDELAKIVECEEKQSLVMIPVLHEVDPSDVLEQAQNLDGDINNNWETVERWRKALASMIKTYQQLYSHWEDGDSSEDGDTDAFIIFRVMLHVSKRLKPPEKMAQTMYYCHWMIPEKTGFLTKGIMLVRDVFRKIAGRIMYAEKLISVVNPSTPARSPAYVQKDKYVTGNELSQLAPSIDFDSLVGMDRQMKAVDALLLNMDSEEDGLGEMGICGEERVGKTTLARCVYQKVSPQFQDHYYFEYQTAHSFGSTCLLEKIARAGLSAKVAVRPGEELERFDELVNANLGHRKVLLIVDIHLYDTGQLENIRNIARRFGPGSRLIYVTQSNRVLLKCGVKHLYKVETLRYDEALQLFSQFAFKQEHVPREYFRLSIRAVLITGRIPLTLKVFGSFLRGKTVSEWESELCRLEASQDNCVAKIVHRCFMVTTYEFLKPLSSHDRQALRRIRK

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-145 TIR
Toll-Interleukin receptor

MKFDVFLSFRGIDTRRTFVSHLLLALFKKQFKTFRQEEEMPWNQPASTQVLEAIENSKIAIVVISKNYTASVSCLDELAKIVECEEKQSLVMIPVLHEVDPSDVLEQAQNLDGDINNNWETVERWRKALASMIKTYQQLYSHWED

Gene3D: G3DSA:3.40.50.10140
2-127 G3DSA:3.40.50.10140

KFDVFLSFRGIDTRRTFVSHLLLALFKKQFKTFRQEEEMPWNQPASTQVLEAIENSKIAIVVISKNYTASVSCLDELAKIVECEEKQSLVMIPVLHEVDPSDVLEQAQNLDGDINNNWETVERWRK

HMMSmart: SM00255
IPR000157
2-135 TIR
Toll-Interleukin receptor

KFDVFLSFRGIDTRRTFVSHLLLALFKKQFKTFRQEEEMPWNQPASTQVLEAIENSKIAIVVISKNYTASVSCLDELAKIVECEEKQSLVMIPVLHEVDPSDVLEQAQNLDGDINNNWETVERWRKALASMIKT

superfamily: SSF52200
IPR000157
3-138 TIR
Toll-Interleukin receptor

FDVFLSFRGIDTRRTFVSHLLLALFKKQFKTFRQEEEMPWNQPASTQVLEAIENSKIAIVVISKNYTASVSCLDELAKIVECEEKQSLVMIPVLHEVDPSDVLEQAQNLDGDINNNWETVERWRKALASMIKTYQQ

HMMPfam: PF01582
IPR000157
5-127 TIR
Toll-Interleukin receptor

VFLSFRGIDTRRTFVSHLLLALFKKQFKTFRQEEEMPWNQPASTQVLEAIENSKIAIVVISKNYTASVSCLDELAKIVECEEKQSLVMIPVLHEVDPSDVLEQAQNLDGDINNNWETVERWRK

HMMPanther: PTHR11017
109-489 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QNLDGDINNNWETVERWRKALASMIKTYQQLYSHWEDGDSSEDGDTDAFIIFRVMLHVSKRLKPPEKMAQTMYYCHWMIPEKTGFLTKGIMLVRDVFRKIAGRIMYAEKLISVVNPSTPARSPAYVQKDKYVTGNELSQLAPSIDFDSLVGMDRQMKAVDALLLNMDSEEDGLGEMGICGEERVGKTTLARCVYQKVSPQFQDHYYFEYQTAHSFGSTCLLEKIARAGLSAKVAVRPGEELERFDELVNANLGHRKVLLIVDIHLYDTGQLENIRNIARRFGPGSRLIYVTQSNRVLLKCGVKHLYKVETLRYDEALQLFSQFAFKQEHVPREYFRLSIRAVLITGRIPLTLKVFGSFLRGKTVSEWESELCRLEASQDNC

HMMPanther: PTHR11017:SF20
109-489 PTHR11017:SF20,SUBFAMILY NOT NAMED

QNLDGDINNNWETVERWRKALASMIKTYQQLYSHWEDGDSSEDGDTDAFIIFRVMLHVSKRLKPPEKMAQTMYYCHWMIPEKTGFLTKGIMLVRDVFRKIAGRIMYAEKLISVVNPSTPARSPAYVQKDKYVTGNELSQLAPSIDFDSLVGMDRQMKAVDALLLNMDSEEDGLGEMGICGEERVGKTTLARCVYQKVSPQFQDHYYFEYQTAHSFGSTCLLEKIARAGLSAKVAVRPGEELERFDELVNANLGHRKVLLIVDIHLYDTGQLENIRNIARRFGPGSRLIYVTQSNRVLLKCGVKHLYKVETLRYDEALQLFSQFAFKQEHVPREYFRLSIRAVLITGRIPLTLKVFGSFLRGKTVSEWESELCRLEASQDNC

superfamily: SSF52540
240-482 SSF52540

VTGNELSQLAPSIDFDSLVGMDRQMKAVDALLLNMDSEEDGLGEMGICGEERVGKTTLARCVYQKVSPQFQDHYYFEYQTAHSFGSTCLLEKIARAGLSAKVAVRPGEELERFDELVNANLGHRKVLLIVDIHLYDTGQLENIRNIARRFGPGSRLIYVTQSNRVLLKCGVKHLYKVETLRYDEALQLFSQFAFKQEHVPREYFRLSIRAVLITGRIPLTLKVFGSFLRGKTVSEWESELCRL

Gene3D: G3DSA:3.40.50.300
247-382 G3DSA:3.40.50.300

QLAPSIDFDSLVGMDRQMKAVDALLLNMDSEEDGLGEMGICGEERVGKTTLARCVYQKVSPQFQDHYYFEYQTAHSFGSTCLLEKIARAGLSAKVAVRPGEELERFDELVNANLGHRKVLLIVDIHLYDTGQLENI

HMMPfam: PF00931
IPR002182
265-489 NB-ARC,NBS
NB-ARC

KAVDALLLNMDSEEDGLGEMGICGEERVGKTTLARCVYQKVSPQFQDHYYFEYQTAHSFGSTCLLEKIARAGLSAKVAVRPGEELERFDELVNANLGHRKVLLIVDIHLYDTGQLENIRNIARRFGPGSRLIYVTQSNRVLLKCGVKHLYKVETLRYDEALQLFSQFAFKQEHVPREYFRLSIRAVLITGRIPLTLKVFGSFLRGKTVSEWESELCRLEASQDNC

FPrintScan: PR00364
IPR000767
283-298 DISEASERSIST
Disease resistance protein

EMGICGEERVGKTTLA

FPrintScan: PR00364
IPR000767
359-373 DISEASERSIST
Disease resistance protein

NLGHRKVLLIVDIHL

FPrintScan: PR00364
IPR000767
453-467 DISEASERSIST
Disease resistance protein

TGRIPLTLKVFGSFL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox