PRGDB00061567 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438126 (FJ842772)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTNL32 disease resistance protein gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTGCAGCCGGAGATACGACGTTTTCCCTAGCTTCAGTGGAGAAGATGTTCGCAAATCATTCCTCAGCCATCTTCTCAAGGAACTCGACCGCAAGTCAATCATTACATTCATAGATCATGGGATCAAGAGAAGCCGCCCTATCGGCCCTGAGCTTTTGTCTGCGATAAGAGAATCGAGGATCTCAGACATAGTCTTCTCTAAAAGTTATGCTTCATCCAGCTGGTGCTTGAATGAGTTGGTGGAAATCCACAAGTGCTATATGGAGGTGGATCAGACGGTGATTCCTATTTTCTACGGCGTTGATCCTTCTGATGTTAGAAAACAGACAGGAGAGTTTGGAAAGGCCTTTGGAGAGACAAGCAAGGGCACAACAGAGGATGAGAAACAAAGGTGGATGCGAGCTCTAGCTGAGGTAGCAAATATGGCCGGAGAGGATCTTCAAAACTGGTGTAACGAAGCCAACTTGATTGATAAGATAGCCGACAATGTTTCGAATAAACTTATTACACCATCGAATTATTTTGGTGATTTCGTTGGGGTCGAAGCTCATTTAGAGGCAATGAATCAATTGTTGTGCATTGAATCTGAGGAAGCTAGAATGGTGGGGATTGTAGGGCCTTCAGGGATTGGTAAGACTACCATAGCAAGAGCTCTTTTCAGTCAACTCTCTAGCCGATTCCACTATCGGGCTTTCTTAGCTTATAGGAGAACCATCCAAGATGACTATGGCATGAAGTTGTGTTGGGAAGAACGGTTTCTCTCAGAAATTCTGTGTCAAAAGGAATTAAAGATATGCTATTTAGGTGTGGTGAAGCAAAGGTTAAAACTCAAGAAAGTTCTTATTTTTCTTGACGATGTTGATGACGTAGAGCTACTCAAGACCTTGGTAGGACGAACTAAATGGTTTGGATCAGGGAGCAGAATTATTGTCATATCTCAAGATAGGCAACTTCTCAAGGCTCATGATATTGACCTTGTTTATAAGGTGGAGTTCCCATCTGAAGATGTTGCTCTCAAAATGCTTTGTCGATCTGCTTTCGGGCAAAACTCTCCACCTAATGGTTTCATGGAACTCGCAGTTGAAGTTGCAAAGCTTGCCGGTAATCTTCCTTTGGGTCTCAATGTCTTGGGTTCGTCTTTACGAGGAAGGGGCAAAGATGAGTGGATGAAGATGATGCCTAGGCTTCGAAATTATTTGGACGGTAAAGTTGAGAAAACATTAAGAGTCAGCTACGATAGGTTAGATGGCAAAGACCAAGAGTTATTTCTCTTCATTGCATTTGCACGTTTATTCAATGGTGTGCAAGTCAGTTACATAAAAGACTTGCTCGGAGATAGTGTTAACACTGGGCTTAAAACGTTGGCTGATAAGTCCCTCATACGTATAACATCGAATGAAACTATAGAGATGCATAACTTGCTACATAAGTTGGCTAGAGAAATTTTCCGTGCAGAGTCCATAAACAATCCTGGAAAACGCCGGTTTCTGGTGGATGTTGAGGACATTCGCGATGTATTTACAGATAAAACCGGCACGGAAACTGTTCTAGGACTATATTTCAACGCATTAAAACTCGAGGAACCATTTTCAATGGATGAAAAATCGTTTGAAGGCATGTGTAATCTCCAGTTTCTCATAGTCAGAGACTATGTTGGTTACTGGGTTCCACAGGGAAAATTGCATCTACCTCAAGGCCTCTTTTATTTACCCCGTAAACTCAGATTGCTCAGGTGGGATGGTTATCCATCCAAGTGCTTGCCTTCTAATTTTAAGGCAGAGTATCTTGTTGAACTCAGAATGAAGAATAGTTCGCTTGAGAAGCTGTGGGAAGGAACTTTGCCACTTGGAAGACTCAAGAAGTTGATTATGAGTTGGTCCACGTACTTAAAAGAACTTCCGGATCTCTCTAATGCCAAAAGCCTCGAGGAAGTATATCTTGATAGATGCACATCTCTGGTGACATTTCCTTCCTCGATTCAGAATCTCCATAAACTGAGGGAGTTGGATTTGGAAGGGTGCACAGAGCTAGAAAGTTTTCCAACTCTTATCAACTTGAAATCTCTCGAGTACCTCAATCTCAGAGAATGCTCCCGGTTGAGAAATTTCCCTCAGATATATATAAACAGTTCTCAAGGATTTAGCCTCGAAGTAGAAGGCTGTTTCTGGAACAATAATCTCTGTGGACTCGATTATCTCGGCTGCATTATGAGATGTATTCCCTGTAAATTTCGCCCAGAACAGCTCATCGGTCTCACAGTGAAAAGCAACATGCTTGAGAGGCTATGGGAAGGCGTCCAGTGTCTTGGAAGTCTCGAAATGATGGATGTGTCAAGCTGTGAAAACCTTACAGAGATTCCAGATCTTTCAATGGCCCCCAATCTCATGTATTTGAGACTCAACAATTGCAAAAGTTTGGTGACTGTTCCTTCTACAATTGGGAGTCTCTGTAAACTGGTGGGGTTGGAAATGAAAGAATGCACAATGTTGGAGGTTCTTCCAACTGATGTCAACTTGTCATCTCTCAGAACACTCTATCTCAGTGGGTGCTCAAGGTTGAGAAGTTTTCCTCAGATTTCAAGGAGCATTGCAAGTCTATATCTAAATGACACCGCCATTGAAGAAGTTCCCTGCTGCATAGAGAATTTCTGGAGGCTCTCTGAACTATCGATGTCTGGTTGCAAGAGGTTGAAAAATATATCTCCGAACTTTTTCAGATTGAGAAGTCTTCATCTAGTAGACTTTTCAGATTGTGGAGAAGTCATCACGGTACTGAGTGATGCCAGCATCAAGGCAAAAATGTCAATAGAGGATCACTTTTCTCTTATACCATTATTTGAAAACACTGAAGAGCGTTACAAAGATGGAGCGGATATAGACTGGGCCGGTGTTTCAAGAAACTTCGAATTTTTAAACTTCAATAATTGCTTTAAACTAGATAGAGATGCGCGGGAACTCATCATACGATCATACATGAAGCCTACGGTCTTACCAGGTGGAGAAGTGCCTACGTATTTCACGCATCGAGCTTCTGGGAATTCTCTAGCTGTTACTTTACCTCAGAGCTCTCTTTCTCAAGACTTCTTGGGATTTAAGGCTTGCATCGCTGTTGAACCTCCAAACAAAGCCGAAACTCCTTATGTACAAATGGGGTTGCGCTGGTACTTTAGAGGCAGAAGCAGTGTGCATCATTTTACGGTTTACCACCACTCATTTAAGATGGATGAGGATCATTTGCTTATGTTCCACTTTGGTTTCCCTCTAGAAGAAGTCAATTATACTTCATCTGAACTAGACTATATCCATGTGGAGTTTGAATATTGCTACCACAAGTATGCTTGTTCTGACATATATGGGCCTGACAGCCACACGCAACCTTGTCTCATGTCGCTCAAGATGATAAAAGGGTGCGGTTTACGGCTCTTGAATCTCTCCGGATCTCCATATGGTGCTGTTAGAATCTCTGAAACAGAGTACAGCCAGCAGTCTGGAGAAAGTGACAGAGAGAGTGGAAGAAGCAATAAGCGAATGCGGATGATGGTAAGAACATCTGAAGAACCTTCCAGCTTACTATGTGGAAAAACAGGAGCGAACACAAGATTGATGACTCCAAATTTGGAGCTTTCATTAGGGCAGGGTGAAACTTCCACTCAGATGTCGTTGAGAAGTCTGATACCATCGTCCTCAGATTCGTCGAGCAGGTTTCATGGAGATGGAGCATTCTTGCGTCATTCCCTTTCTCCTTCTGAGCCATGTTTCAGCGGAGAAGCTTTTAATCCCATGATAACAGAACAACAAGACACAGATACACACTTTGTGGATCAGTCGTCGTCTCCTCAGCTTATTACATTTTTAAGGTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MASSSCSRRYDVFPSFSGEDVRKSFLSHLLKELDRKSIITFIDHGIKRSRPIGPELLSAIRESRISDIVFSKSYASSSWCLNELVEIHKCYMEVDQTVIPIFYGVDPSDVRKQTGEFGKAFGETSKGTTEDEKQRWMRALAEVANMAGEDLQNWCNEANLIDKIADNVSNKLITPSNYFGDFVGVEAHLEAMNQLLCIESEEARMVGIVGPSGIGKTTIARALFSQLSSRFHYRAFLAYRRTIQDDYGMKLCWEERFLSEILCQKELKICYLGVVKQRLKLKKVLIFLDDVDDVELLKTLVGRTKWFGSGSRIIVISQDRQLLKAHDIDLVYKVEFPSEDVALKMLCRSAFGQNSPPNGFMELAVEVAKLAGNLPLGLNVLGSSLRGRGKDEWMKMMPRLRNYLDGKVEKTLRVSYDRLDGKDQELFLFIAFARLFNGVQVSYIKDLLGDSVNTGLKTLADKSLIRITSNETIEMHNLLHKLAREIFRAESINNPGKRRFLVDVEDIRDVFTDKTGTETVLGLYFNALKLEEPFSMDEKSFEGMCNLQFLIVRDYVGYWVPQGKLHLPQGLFYLPRKLRLLRWDGYPSKCLPSNFKAEYLVELRMKNSSLEKLWEGTLPLGRLKKLIMSWSTYLKELPDLSNAKSLEEVYLDRCTSLVTFPSSIQNLHKLRELDLEGCTELESFPTLINLKSLEYLNLRECSRLRNFPQIYINSSQGFSLEVEGCFWNNNLCGLDYLGCIMRCIPCKFRPEQLIGLTVKSNMLERLWEGVQCLGSLEMMDVSSCENLTEIPDLSMAPNLMYLRLNNCKSLVTVPSTIGSLCKLVGLEMKECTMLEVLPTDVNLSSLRTLYLSGCSRLRSFPQISRSIASLYLNDTAIEEVPCCIENFWRLSELSMSGCKRLKNISPNFFRLRSLHLVDFSDCGEVITVLSDASIKAKMSIEDHFSLIPLFENTEERYKDGADIDWAGVSRNFEFLNFNNCFKLDRDARELIIRSYMKPTVLPGGEVPTYFTHRASGNSLAVTLPQSSLSQDFLGFKACIAVEPPNKAETPYVQMGLRWYFRGRSSVHHFTVYHHSFKMDEDHLLMFHFGFPLEEVNYTSSELDYIHVEFEYCYHKYACSDIYGPDSHTQPCLMSLKMIKGCGLRLLNLSGSPYGAVRISETEYSQQSGESDRESGRSNKRMRMMVRTSEEPSSLLCGKTGANTRLMTPNLELSLGQGETSTQMSLRSLIPSSSDSSSRFHGDGAFLRHSLSPSEPCFSGEAFNPMITEQQDTDTHFVDQSSSPQLITFLR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-149 TIR
Toll-Interleukin receptor

ASSSCSRRYDVFPSFSGEDVRKSFLSHLLKELDRKSIITFIDHGIKRSRPIGPELLSAIRESRISDIVFSKSYASSSWCLNELVEIHKCYMEVDQTVIPIFYGVDPSDVRKQTGEFGKAFGETSKGTTEDEKQRWMRALAEVANMAGE

ProfileScan: PS50104
IPR000157
8-146 TIR
Toll-Interleukin receptor

RRYDVFPSFSGEDVRKSFLSHLLKELDRKSIITFIDHGIKRSRPIGPELLSAIRESRISDIVFSKSYASSSWCLNELVEIHKCYMEVDQTVIPIFYGVDPSDVRKQTGEFGKAFGETSKGTTEDEKQRWMRALAEVANM

Gene3D: G3DSA:3.40.50.10140
8-145 G3DSA:3.40.50.10140

RRYDVFPSFSGEDVRKSFLSHLLKELDRKSIITFIDHGIKRSRPIGPELLSAIRESRISDIVFSKSYASSSWCLNELVEIHKCYMEVDQTVIPIFYGVDPSDVRKQTGEFGKAFGETSKGTTEDEKQRWMRALAEVAN

HMMSmart: SM00255
IPR000157
9-146 TIR
Toll-Interleukin receptor

RYDVFPSFSGEDVRKSFLSHLLKELDRKSIITFIDHGIKRSRPIGPELLSAIRESRISDIVFSKSYASSSWCLNELVEIHKCYMEVDQTVIPIFYGVDPSDVRKQTGEFGKAFGETSKGTTEDEKQRWMRALAEVANM

HMMPfam: PF01582
IPR000157
12-141 TIR
Toll-Interleukin receptor

VFPSFSGEDVRKSFLSHLLKELDRKSIITFIDHGIKRSRPIGPELLSAIRESRISDIVFSKSYASSSWCLNELVEIHKCYMEVDQTVIPIFYGVDPSDVRKQTGEFGKAFGETSKGTTEDEKQRWMRALA

HMMPanther: PTHR11017:SF20
31-1107 PTHR11017:SF20,SUBFAMILY NOT NAMED

KELDRKSIITFIDHGIKRSRPIGPELLSAIRESRISDIVFSKSYASSSWCLNELVEIHKCYMEVDQTVIPIFYGVDPSDVRKQTGEFGKAFGETSKGTTEDEKQRWMRALAEVANMAGEDLQNWCNEANLIDKIADNVSNKLITPSNYFGDFVGVEAHLEAMNQLLCIESEEARMVGIVGPSGIGKTTIARALFSQLSSRFHYRAFLAYRRTIQDDYGMKLCWEERFLSEILCQKELKICYLGVVKQRLKLKKVLIFLDDVDDVELLKTLVGRTKWFGSGSRIIVISQDRQLLKAHDIDLVYKVEFPSEDVALKMLCRSAFGQNSPPNGFMELAVEVAKLAGNLPLGLNVLGSSLRGRGKDEWMKMMPRLRNYLDGKVEKTLRVSYDRLDGKDQELFLFIAFARLFNGVQVSYIKDLLGDSVNTGLKTLADKSLIRITSNETIEMHNLLHKLAREIFRAESINNPGKRRFLVDVEDIRDVFTDKTGTETVLGLYFNALKLEEPFSMDEKSFEGMCNLQFLIVRDYVGYWVPQGKLHLPQGLFYLPRKLRLLRWDGYPSKCLPSNFKAEYLVELRMKNSSLEKLWEGTLPLGRLKKLIMSWSTYLKELPDLSNAKSLEEVYLDRCTSLVTFPSSIQNLHKLRELDLEGCTELESFPTLINLKSLEYLNLRECSRLRNFPQIYINSSQGFSLEVEGCFWNNNLCGLDYLGCIMRCIPCKFRPEQLIGLTVKSNMLERLWEGVQCLGSLEMMDVSSCENLTEIPDLSMAPNLMYLRLNNCKSLVTVPSTIGSLCKLVGLEMKECTMLEVLPTDVNLSSLRTLYLSGCSRLRSFPQISRSIASLYLNDTAIEEVPCCIENFWRLSELSMSGCKRLKNISPNFFRLRSLHLVDFSDCGEVITVLSDASIKAKMSIEDHFSLIPLFENTEERYKDGADIDWAGVSRNFEFLNFNNCFKLDRDARELIIRSYMKPTVLPGGEVPTYFTHRASGNSLAVTLPQSSLSQDFLGFKACIAVEPPNKAETPYVQMGLRWYFRGRSSVHHFTVYHHSFKMDEDHLLMFHFGFPLEEVNYTSSELDYIHV

HMMPanther: PTHR11017
31-1107 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KELDRKSIITFIDHGIKRSRPIGPELLSAIRESRISDIVFSKSYASSSWCLNELVEIHKCYMEVDQTVIPIFYGVDPSDVRKQTGEFGKAFGETSKGTTEDEKQRWMRALAEVANMAGEDLQNWCNEANLIDKIADNVSNKLITPSNYFGDFVGVEAHLEAMNQLLCIESEEARMVGIVGPSGIGKTTIARALFSQLSSRFHYRAFLAYRRTIQDDYGMKLCWEERFLSEILCQKELKICYLGVVKQRLKLKKVLIFLDDVDDVELLKTLVGRTKWFGSGSRIIVISQDRQLLKAHDIDLVYKVEFPSEDVALKMLCRSAFGQNSPPNGFMELAVEVAKLAGNLPLGLNVLGSSLRGRGKDEWMKMMPRLRNYLDGKVEKTLRVSYDRLDGKDQELFLFIAFARLFNGVQVSYIKDLLGDSVNTGLKTLADKSLIRITSNETIEMHNLLHKLAREIFRAESINNPGKRRFLVDVEDIRDVFTDKTGTETVLGLYFNALKLEEPFSMDEKSFEGMCNLQFLIVRDYVGYWVPQGKLHLPQGLFYLPRKLRLLRWDGYPSKCLPSNFKAEYLVELRMKNSSLEKLWEGTLPLGRLKKLIMSWSTYLKELPDLSNAKSLEEVYLDRCTSLVTFPSSIQNLHKLRELDLEGCTELESFPTLINLKSLEYLNLRECSRLRNFPQIYINSSQGFSLEVEGCFWNNNLCGLDYLGCIMRCIPCKFRPEQLIGLTVKSNMLERLWEGVQCLGSLEMMDVSSCENLTEIPDLSMAPNLMYLRLNNCKSLVTVPSTIGSLCKLVGLEMKECTMLEVLPTDVNLSSLRTLYLSGCSRLRSFPQISRSIASLYLNDTAIEEVPCCIENFWRLSELSMSGCKRLKNISPNFFRLRSLHLVDFSDCGEVITVLSDASIKAKMSIEDHFSLIPLFENTEERYKDGADIDWAGVSRNFEFLNFNNCFKLDRDARELIIRSYMKPTVLPGGEVPTYFTHRASGNSLAVTLPQSSLSQDFLGFKACIAVEPPNKAETPYVQMGLRWYFRGRSSVHHFTVYHHSFKMDEDHLLMFHFGFPLEEVNYTSSELDYIHV

superfamily: SSF52540
165-408 SSF52540

ADNVSNKLITPSNYFGDFVGVEAHLEAMNQLLCIESEEARMVGIVGPSGIGKTTIARALFSQLSSRFHYRAFLAYRRTIQDDYGMKLCWEERFLSEILCQKELKICYLGVVKQRLKLKKVLIFLDDVDDVELLKTLVGRTKWFGSGSRIIVISQDRQLLKAHDIDLVYKVEFPSEDVALKMLCRSAFGQNSPPNGFMELAVEVAKLAGNLPLGLNVLGSSLRGRGKDEWMKMMPRLRNYLDGKV

Gene3D: G3DSA:3.40.50.300
180-217 G3DSA:3.40.50.300

GDFVGVEAHLEAMNQLLCIESEEARMVGIVGPSGIGKT

HMMPfam: PF00931
IPR002182
186-431 NB-ARC,NBS
NB-ARC

EAHLEAMNQLLCIESEEARMVGIVGPSGIGKTTIARALFSQLSSRFHYRAFLAYRRTIQDDYGMKLCWEERFLSEILCQKELKICYLGVVKQRLKLKKVLIFLDDVDDVELLKTLVGRTKWFGSGSRIIVISQDRQLLKAHDIDLVYKVEFPSEDVALKMLCRSAFGQNSPPNGFMELAVEVAKLAGNLPLGLNVLGSSLRGRGKDEWMKMMPRLRNYLDGKVEKTLRVSYDRLDGKDQELFLFIA

FPrintScan: PR00364
IPR000767
205-220 DISEASERSIST
Disease resistance protein

MVGIVGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
218-348 G3DSA:3.40.50.300

TIARALFSQLSSRFHYRAFLAYRRTIQDDYGMKLCWEERFLSEILCQKELKICYLGVVKQRLKLKKVLIFLDDVDDVELLKTLVGRTKWFGSGSRIIVISQDRQLLKAHDIDLVYKVEFPSEDVALKMLCR

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

RLKLKKVLIFLDDVD

FPrintScan: PR00364
IPR000767
371-385 DISEASERSIST
Disease resistance protein

AGNLPLGLNVLGSSL

superfamily: SSF46785
406-512 SSF46785

GKVEKTLRVSYDRLDGKDQELFLFIAFARLFNGVQVSYIKDLLGDSVNTGLKTLADKSLIRITSNETIEMHNLLHKLAREIFRAESINNPGKRRFLVDVEDIRDVFT

superfamily: SSF52058
474-725 SSF52058,LRR

EMHNLLHKLAREIFRAESINNPGKRRFLVDVEDIRDVFTDKTGTETVLGLYFNALKLEEPFSMDEKSFEGMCNLQFLIVRDYVGYWVPQGKLHLPQGLFYLPRKLRLLRWDGYPSKCLPSNFKAEYLVELRMKNSSLEKLWEGTLPLGRLKKLIMSWSTYLKELPDLSNAKSLEEVYLDRCTSLVTFPSSIQNLHKLRELDLEGCTELESFPTLINLKSLEYLNLRECSRLRNFPQIYINSSQGFSLEVEGC

Gene3D: G3DSA:3.80.10.10
535-708 G3DSA:3.80.10.10

SMDEKSFEGMCNLQFLIVRDYVGYWVPQGKLHLPQGLFYLPRKLRLLRWDGYPSKCLPSNFKAEYLVELRMKNSSLEKLWEGTLPLGRLKKLIMSWSTYLKELPDLSNAKSLEEVYLDRCTSLVTFPSSIQNLHKLRELDLEGCTELESFPTLINLKSLEYLNLRECSRLRNFP

HMMPfam: PF07725
IPR011713
599-617 LRR_3
Leucine-rich repeat 3

YLVELRMKNSSLEKLWEGT

HMMPfam: PF13855
645-701 LRR_8,Leucine rich repeat

SLEEVYLDRCTSLVTFPSSIQNLHKLRELDLEGCTELESFPTLINLKSLEYLNLREC

Gene3D: G3DSA:3.80.10.10
730-922 G3DSA:3.80.10.10

NLCGLDYLGCIMRCIPCKFRPEQLIGLTVKSNMLERLWEGVQCLGSLEMMDVSSCENLTEIPDLSMAPNLMYLRLNNCKSLVTVPSTIGSLCKLVGLEMKECTMLEVLPTDVNLSSLRTLYLSGCSRLRSFPQISRSIASLYLNDTAIEEVPCCIENFWRLSELSMSGCKRLKNISPNFFRLRSLHLVDFSDC

superfamily: SSF52058
730-922 SSF52058,LRR

NLCGLDYLGCIMRCIPCKFRPEQLIGLTVKSNMLERLWEGVQCLGSLEMMDVSSCENLTEIPDLSMAPNLMYLRLNNCKSLVTVPSTIGSLCKLVGLEMKECTMLEVLPTDVNLSSLRTLYLSGCSRLRSFPQISRSIASLYLNDTAIEEVPCCIENFWRLSELSMSGCKRLKNISPNFFRLRSLHLVDFSDC

FPrintScan: PR00364
IPR000767
841-857 DISEASERSIST
Disease resistance protein

VNLSSLRTLYLSGCSRL

HMMPfam: PF00560
IPR001611
845-862 LRR_1
Leucine-rich repeat

SLRTLYLSGCSRLRSFPQ


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox