PRGDB00061573 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 227438114 (FJ842766)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Brassica rapa subsp. pekinensis

Comment?

Brassica rapa subsp. pekinensis isolate BrTN4 disease resistance protein gene, complete cds.

DNA Sequence

ATGGATTCTTCTTCTTCTTCATCTTCATCAACTCGCCACTACAACTACGATGTCTTCCCAAGCTTCTCCGGTCAAGATGTCCGCAGAACTTTTCTCAGCCACTTTCTTGAAGCTTTGAAAAGCAAGGGAATCAAAACATTCATAGATAATGGGATCATAAGAAGCGAGTCTATCAACTCTGAGCTCATAAGAGCTATCAGGGAATCAAGGATTGCTGTCGTGATCCTATCTAAGAACTATGCTTCTTCGAGCTGGTGTCTAAACGAGTTGCAGCTGATCATGGAGTGCACGGTTTCTTTAGGCCAAACTGTGATGACAGTCTTTTACGATGTGGAACCATCTGATGTTAGAAAGCAGACTGGAGATTTTGGAAAGGCCTTTAAAGAAACTTGTTACCGGAAGACAGAGGAAGAGAAGAAGAAATGGAGTGAAGCTTTATCTCAAGTTGCAGTTATTGCCGGAGAACATTCTGTTTCATGGTACTGTTCCAAGCTTTTGTACAATGCATTTTTTATATATTATGATTGTTTTTTAGAATTACCTAGAATATCAGCAACACATACTATTCAAAAAATAGCTCAACAGAGGAAACGTTCCCAAATAGATTTAGAGTATGGAGTGGAGGTAAGGGCTGGTGAGGCTGAGATGATCTCGAAAATCGTCATGGATGTATCTAATGAGTTACCATCAACGGATTTCGATCAGTTAGTTGGAGTTGAAGCTCATCTAGAAAAGATGAGATCGGTCATATGCTTAGACTCCGACGAGGTGAAGATTGTGGGGATCTGGGGTCCTGATGGTATTGGCAAAAGCACCATAGTAAGAGCTTTATACAACAACATTTCCAGCAACTTCCAACTTAAGTTTTATAGGGAGAGAGGTCCAACTAACTCGATGGGATTACTATCGGAAGTGCTATCTGGAATGTTAGATCATAGAGACATGAAGATACTTGACCTGCAAGACGCGCAATATAGGTTAACGCGCCAGAGAGTACTTCTTGTTCTTGATGATGTCGCTTCCCAGCATCTACAAGTTTTGCAAAATCTATTTCGGAGTCTTTTATTCGGAAGTAAGGTGATTGTGGTGAATAAAGATATAGAAACATTTACTCATAATGGTATAGAGCAGATATACAAAGTTCCTTACCCATCGAGCGAAGAGGCTCTACAGATCTTTTCATACTCTGCGTTTGGGCAAAGCTCTCCGCCCAGAGGATACTTTAAGCATGCTGTTGAAGTATCTAAGCTTATTGCACCTTTTCCACTTGGTCTTAAGGTCTTGGGTTCGGCTCTACGTGGGAAGAGCGAAGAGGAGTGGACAACGGCACCGGCTAAACTCAGAGCCTATCTTGGGGATAAGGATATTGAGAAAACAATTAGATTTGCTGTCGATGGCTTATCTGAGAAACATAAAAATTTGTATTTTTCATTAACTTCAGCTAGTAACCGGGGTAAGAACCTGAAGGACTCCATATACTTGCTAGCCAAGGGAGACGACTGGGACGTGGAGAAAGAAATACAAACCCTAGCTGACATGGCTCTCATCTATATATCTAGTGAAGGAGAAATCATGATGCACGATTTGCTATCGAGGCCTCCTACTGTCGTATCACCATTCATTTGGTTCCTCCTAGATTACTATTACGCCGGAACTGGCAGAAGAAAAGAATCACGATATGGGTCCAACTATTTTCACGATGGAGCCAATACCATGTCCTTGTCATCTACGTATATGAACCAGGGGCGGAGGTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Brassica rapa subsp. pekinensis].

MDSSSSSSSSTRHYNYDVFPSFSGQDVRRTFLSHFLEALKSKGIKTFIDNGIIRSESINSELIRAIRESRIAVVILSKNYASSSWCLNELQLIMECTVSLGQTVMTVFYDVEPSDVRKQTGDFGKAFKETCYRKTEEEKKKWSEALSQVAVIAGEHSVSWYCSKLLYNAFFIYYDCFLELPRISATHTIQKIAQQRKRSQIDLEYGVEVRAGEAEMISKIVMDVSNELPSTDFDQLVGVEAHLEKMRSVICLDSDEVKIVGIWGPDGIGKSTIVRALYNNISSNFQLKFYRERGPTNSMGLLSEVLSGMLDHRDMKILDLQDAQYRLTRQRVLLVLDDVASQHLQVLQNLFRSLLFGSKVIVVNKDIETFTHNGIEQIYKVPYPSSEEALQIFSYSAFGQSSPPRGYFKHAVEVSKLIAPFPLGLKVLGSALRGKSEEEWTTAPAKLRAYLGDKDIEKTIRFAVDGLSEKHKNLYFSLTSASNRGKNLKDSIYLLAKGDDWDVEKEIQTLADMALIYISSEGEIMMHDLLSRPPTVVSPFIWFLLDYYYAGTGRRKESRYGSNYFHDGANTMSLSSTYMNQGRR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-155 TIR
Toll-Interleukin receptor

SSSSSSSTRHYNYDVFPSFSGQDVRRTFLSHFLEALKSKGIKTFIDNGIIRSESINSELIRAIRESRIAVVILSKNYASSSWCLNELQLIMECTVSLGQTVMTVFYDVEPSDVRKQTGDFGKAFKETCYRKTEEEKKKWSEALSQVAVIAGE

Gene3D: G3DSA:3.40.50.10140
11-150 G3DSA:3.40.50.10140

TRHYNYDVFPSFSGQDVRRTFLSHFLEALKSKGIKTFIDNGIIRSESINSELIRAIRESRIAVVILSKNYASSSWCLNELQLIMECTVSLGQTVMTVFYDVEPSDVRKQTGDFGKAFKETCYRKTEEEKKKWSEALSQVA

ProfileScan: PS50104
IPR000157
14-152 TIR
Toll-Interleukin receptor

YNYDVFPSFSGQDVRRTFLSHFLEALKSKGIKTFIDNGIIRSESINSELIRAIRESRIAVVILSKNYASSSWCLNELQLIMECTVSLGQTVMTVFYDVEPSDVRKQTGDFGKAFKETCYRKTEEEKKKWSEALSQVAVI

HMMSmart: SM00255
IPR000157
15-152 TIR
Toll-Interleukin receptor

NYDVFPSFSGQDVRRTFLSHFLEALKSKGIKTFIDNGIIRSESINSELIRAIRESRIAVVILSKNYASSSWCLNELQLIMECTVSLGQTVMTVFYDVEPSDVRKQTGDFGKAFKETCYRKTEEEKKKWSEALSQVAVI

HMMPfam: PF01582
IPR000157
18-147 TIR
Toll-Interleukin receptor

VFPSFSGQDVRRTFLSHFLEALKSKGIKTFIDNGIIRSESINSELIRAIRESRIAVVILSKNYASSSWCLNELQLIMECTVSLGQTVMTVFYDVEPSDVRKQTGDFGKAFKETCYRKTEEEKKKWSEALS

HMMPanther: PTHR11017
85-530 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

WCLNELQLIMECTVSLGQTVMTVFYDVEPSDVRKQTGDFGKAFKETCYRKTEEEKKKWSEALSQVAVIAGEHSVSWYCSKLLYNAFFIYYDCFLELPRISATHTIQKIAQQRKRSQIDLEYGVEVRAGEAEMISKIVMDVSNELPSTDFDQLVGVEAHLEKMRSVICLDSDEVKIVGIWGPDGIGKSTIVRALYNNISSNFQLKFYRERGPTNSMGLLSEVLSGMLDHRDMKILDLQDAQYRLTRQRVLLVLDDVASQHLQVLQNLFRSLLFGSKVIVVNKDIETFTHNGIEQIYKVPYPSSEEALQIFSYSAFGQSSPPRGYFKHAVEVSKLIAPFPLGLKVLGSALRGKSEEEWTTAPAKLRAYLGDKDIEKTIRFAVDGLSEKHKNLYFSLTSASNRGKNLKDSIYLLAKGDDWDVEKEIQTLADMALIYISSEGEIMMHDLL

HMMPanther: PTHR11017:SF20
85-530 PTHR11017:SF20,SUBFAMILY NOT NAMED

WCLNELQLIMECTVSLGQTVMTVFYDVEPSDVRKQTGDFGKAFKETCYRKTEEEKKKWSEALSQVAVIAGEHSVSWYCSKLLYNAFFIYYDCFLELPRISATHTIQKIAQQRKRSQIDLEYGVEVRAGEAEMISKIVMDVSNELPSTDFDQLVGVEAHLEKMRSVICLDSDEVKIVGIWGPDGIGKSTIVRALYNNISSNFQLKFYRERGPTNSMGLLSEVLSGMLDHRDMKILDLQDAQYRLTRQRVLLVLDDVASQHLQVLQNLFRSLLFGSKVIVVNKDIETFTHNGIEQIYKVPYPSSEEALQIFSYSAFGQSSPPRGYFKHAVEVSKLIAPFPLGLKVLGSALRGKSEEEWTTAPAKLRAYLGDKDIEKTIRFAVDGLSEKHKNLYFSLTSASNRGKNLKDSIYLLAKGDDWDVEKEIQTLADMALIYISSEGEIMMHDLL

superfamily: SSF52540
219-454 SSF52540

KIVMDVSNELPSTDFDQLVGVEAHLEKMRSVICLDSDEVKIVGIWGPDGIGKSTIVRALYNNISSNFQLKFYRERGPTNSMGLLSEVLSGMLDHRDMKILDLQDAQYRLTRQRVLLVLDDVASQHLQVLQNLFRSLLFGSKVIVVNKDIETFTHNGIEQIYKVPYPSSEEALQIFSYSAFGQSSPPRGYFKHAVEVSKLIAPFPLGLKVLGSALRGKSEEEWTTAPAKLRAYLGDK

Gene3D: G3DSA:3.40.50.300
232-270 G3DSA:3.40.50.300

DFDQLVGVEAHLEKMRSVICLDSDEVKIVGIWGPDGIGK

HMMPfam: PF00931
IPR002182
240-494 NB-ARC,NBS
NB-ARC

EAHLEKMRSVICLDSDEVKIVGIWGPDGIGKSTIVRALYNNISSNFQLKFYRERGPTNSMGLLSEVLSGMLDHRDMKILDLQDAQYRLTRQRVLLVLDDVASQHLQVLQNLFRSLLFGSKVIVVNKDIETFTHNGIEQIYKVPYPSSEEALQIFSYSAFGQSSPPRGYFKHAVEVSKLIAPFPLGLKVLGSALRGKSEEEWTTAPAKLRAYLGDKDIEKTIRFAVDGLSEKHKNLYFSLTSASNRGKNLKDSIYL

FPrintScan: PR00364
IPR000767
259-274 DISEASERSIST
Disease resistance protein

IVGIWGPDGIGKSTIV

Gene3D: G3DSA:3.40.50.300
271-356 G3DSA:3.40.50.300

STIVRALYNNISSNFQLKFYRERGPTNSMGLLSEVLSGMLDHRDMKILDLQDAQYRLTRQRVLLVLDDVASQHLQVLQNLFRSLLF

FPrintScan: PR00364
IPR000767
326-340 DISEASERSIST
Disease resistance protein

RLTRQRVLLVLDDVA

FPrintScan: PR00364
IPR000767
418-432 DISEASERSIST
Disease resistance protein

IAPFPLGLKVLGSAL


List of References

Jeong-Hwan Mun, Hee-Ju Yu, Soomin Park, Beom-Seok Park
Genome-wide identification of NBS-encoding resistance genes in Brassica rapa.
Mol. Genet. Genomics: 2009, 282(6);617-31
PubMed:19838736 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox