PRGDB00061577 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223452507 (FJ014828)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

Glycine max clone cw147 disease resistance protein mRNA, complete cds.

DNA Sequence

ATGACCTTGCATCCCTACTTTGAACCAACATACTTGTGCCCTTGTGATGTCATCTCCCCCATAGAAATCATATTGACAACAGTAGAAGCCCAAATTGTTGAGGATCAACAACAATCATTGCTCAAACTAAAGAATAGCCTCAAATTCAAGACTAATAAGTCTACAAAACTTGTGTCTTGGAATCCAACCGTAGATTTCTGTGAGTGGAGGGGTGTTGCCTGTGACGAGGAGAGGCAAGTTACAGGCCTTGACTTGAGTGGAGAATCTATCTATGGTGAATTTGACAATTCAAGTACTCTTTTCACTTTGCAAAATCTCCAGATACTGAATTTGTCTGATAATAACTTCAGTTCTGAGATACCATCCGGTTTCAACAAGTTGAAGAACTTAACATATCTGAATTTGTCTCATGCTGGCTTTGTGGGGCAGATTCCAACAGAGATTTCTTACCTGGCAAGGTTGGTAACTCTTGATATCTCTTCTGTTTCCTATTTATATGGGCAACCACTGAAACTTGAAAACATAGATCTACAAATGCTTGTCCAAAACCTCACCATGCTTAGACAATTGTATATGGATGGTGTAATTGTAACAACTCAGGGAAATAAATGGAGCAATGCTTTGTTTAAACTTGTTAACCTGCAGGAGCTGAGCATGTCAAACTGCAATCTCTCTGGACCCCTTGATCCTTCCTTGACAAGACTTCAGAATCTATCAGTCATTCGTCTTGATCAGAACAATTTCTCATCCCCAGTGCCAGAAACCTTTGCTAATTTTACAAATTTAACCACCCTTCACCTTAGTTCTTGTGAATTGACTGGAACATTTCCAGAGAAAATCTTTCAGGTAGCAACATTGTCTGTTGTAGACTTATCATTCAATTATAATCTGTATGGATCTTTGCTTGAATTCCCACTGAATAGTCCTCTTCAGACATTGATTGTGAGTGGCACAAGTTTCTCGGGAGGAATACCACCTTCTATAAATAATCTTGGGCAGTTATCCATCTTAGATCTTTCTAATTGCCATTTTAACGGAACACTACCCAGTTCAATGTCAAGACTCAGGGAACTCACTTATCTGGATTTGTCATTGAATGACTTCACTGGTCAAATTCCATCCCTGAATATGTCCAAGAATCTCACGCATTTACACTTCTGGAAGAATGGTTTCACAGGTTCAATCACATCTTATCATTTTGGCGGCCTAAGAAATCTGCTCCAAATTGATTTGCAGGACAACTTCCTGGATGGAAGCCTTCCTTCCTCTCTTTTTTCTCTCCCACTGCTACGAAGTATTCGACTTTCCAACAACAATTTCCAGGATCAACTGAATAAATTTTCAAATATCTCTTCCTCCAAGTTAGAGATCCTTGATTTAAGTGGAAATGATTTAAACGGGTCCATTCCTACAGATATTTTTCAACTCAGATCACTTTGTGTCCTTGAACTATCTTCAAACAAGTTAAATGGCAGATTGAAGCTAGATGTGATTCATAGACTTGTAAATCTAAGTACACTGGGACTTTCACACAACCATTTGTCAATAGACACAAATTTTGCAGATGTTGGCCTAATATCTTCCATCCCCAATATGAAAATTGTAGAGCTGGCCTCCTGCAACCTGACAGAGTTCCCTAGTTTCTTGAGAAACCAATCAAAAATAACAACTTTAGACCTCTCAAGCAACAATATTCAAGGATCTATACCAACATGGATTTGGCAACTTAACTCTCTCGTTCAATTAAATCTCTCTCACAATTTACTCAGCAATTTAGAAGGACCTGTGCAGAACCCTAGTTCGAATTTGAGGCTCCTTGACCTTCATGATAATCACCTCCAAGGGAAGCTTCAAATATTTCCGGTGCATGCCTCTTATTTGGACTATTCAAGCAATAACTTCAGTTTCACTATTCCATCAGATATTGGTAATTTTCTGTCTTCAACAATTTTCCTGTCTCTTTCCAAAAACAATTTATCTGGGAATATTCCACAATCCTTGTGCAGTAGTTCAAGTATGCTAGTTCTGGATTTTTCCTATAATCACTTGAATGGGAAAATTCCAGAGTGCTTAACACAGAGTGAGAGACTTGTGGTATTAGATCTGCAACATAACAAGTTCTATGGCAGCATTCCAGACAAATTTCCAGTATCTTGTGTTCTAAGGACTCTGGATCTTAATAGTAATCTATTGTGGGGCTCAATTCCCAAATCTCTTGCAAATTGCACATCATTAGAGGTGTTGGATCTTGGTAACAATCAGGTAGATGATGGATTTCCATGTTTCTTAAAGACAATATCCACACTCCGTGTCATGGTTTTGAGGGGAAACAAATTCCATGGTCACGTTGGATGTCCTTATTCTAATAGTACTTGGTATATGCTTCAAATTGTGGACTTGTCAGTCAACAATTTCAGTGGTGTACTTCCAAAAAACTGCTTCAAAACTTGGAAGGCAATGATGCTTGATGAAGATGATGATGGATCAAAGTTCAATCACATTGCATCTCAAGTCCTTAAGTTTGGTGGTATATATTATCAGGGTTCTGTGACACTTACAAGCAAAGGTTTACAGATGGAGTTTGTTAACATCCTAACTGGCTTCACATCTGTTGACTTCTCATCCAACAATTTTGAAGGAACAATACCAGAAGAGCTTATGAATTTTACAAGACTTAATTTGCTCGACTTGTCAGATAATGCTTTAGCAGGCCAAATCCCTTCATCTATAGGGAATTTAAAACAGCTTGAAGCATTGGACCTGTCAAGCAACCATTTTGATGGAGAAATTCCCACACAGCTTGCAAATTTAAATTTCCTCTCGTACCTAGACCTTTCCTCTAATCGTCTGGTGGGAAAAATCCCCGTAGGTATCCAGCTTCAAACATTTGATGCATCTTCCTTTGTTGGTAATGCAGAATTGTGTGGAGCACCTTTGCCTAAAAACTGCAGTAATGAAACATATGGGCTGCCATGCACATTTGGTTGGAATATCATTATGGTTGAATTGGGATTTGTTTTTGGCCTTGCACTTGTTATTGATCCCCTTCTGTTTTGGAAGCAATGGAGGCAATGGTACTGGAAACGCGTGGACCTCATTCTGTGTCGTATCTTCCCACAGCTGAATCTTGAATATGAAAGCAGTGGAGGACATTGCTATCAAGTTTTAAGATTATTCATGATCCTGCTTTCATTTAATAATCCATATAAATCAAATGATGATGAGAAAATATCACAGATAATTATTATGTCTCTTAAGCATATTGTTACCGGAAAAAGTTCATGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Glycine max].

MTLHPYFEPTYLCPCDVISPIEIILTTVEAQIVEDQQQSLLKLKNSLKFKTNKSTKLVSWNPTVDFCEWRGVACDEERQVTGLDLSGESIYGEFDNSSTLFTLQNLQILNLSDNNFSSEIPSGFNKLKNLTYLNLSHAGFVGQIPTEISYLARLVTLDISSVSYLYGQPLKLENIDLQMLVQNLTMLRQLYMDGVIVTTQGNKWSNALFKLVNLQELSMSNCNLSGPLDPSLTRLQNLSVIRLDQNNFSSPVPETFANFTNLTTLHLSSCELTGTFPEKIFQVATLSVVDLSFNYNLYGSLLEFPLNSPLQTLIVSGTSFSGGIPPSINNLGQLSILDLSNCHFNGTLPSSMSRLRELTYLDLSLNDFTGQIPSLNMSKNLTHLHFWKNGFTGSITSYHFGGLRNLLQIDLQDNFLDGSLPSSLFSLPLLRSIRLSNNNFQDQLNKFSNISSSKLEILDLSGNDLNGSIPTDIFQLRSLCVLELSSNKLNGRLKLDVIHRLVNLSTLGLSHNHLSIDTNFADVGLISSIPNMKIVELASCNLTEFPSFLRNQSKITTLDLSSNNIQGSIPTWIWQLNSLVQLNLSHNLLSNLEGPVQNPSSNLRLLDLHDNHLQGKLQIFPVHASYLDYSSNNFSFTIPSDIGNFLSSTIFLSLSKNNLSGNIPQSLCSSSSMLVLDFSYNHLNGKIPECLTQSERLVVLDLQHNKFYGSIPDKFPVSCVLRTLDLNSNLLWGSIPKSLANCTSLEVLDLGNNQVDDGFPCFLKTISTLRVMVLRGNKFHGHVGCPYSNSTWYMLQIVDLSVNNFSGVLPKNCFKTWKAMMLDEDDDGSKFNHIASQVLKFGGIYYQGSVTLTSKGLQMEFVNILTGFTSVDFSSNNFEGTIPEELMNFTRLNLLDLSDNALAGQIPSSIGNLKQLEALDLSSNHFDGEIPTQLANLNFLSYLDLSSNRLVGKIPVGIQLQTFDASSFVGNAELCGAPLPKNCSNETYGLPCTFGWNIIMVELGFVFGLALVIDPLLFWKQWRQWYWKRVDLILCRIFPQLNLEYESSGGHCYQVLRLFMILLSFNNPYKSNDDEKISQIIIMSLKHIVTGKSS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
28-1026 PTHR24420,FAMILY NOT NAMED

VEAQIVEDQQQSLLKLKNSLKFKTNKSTKLVSWNPTVDFCEWRGVACDEERQVTGLDLSGESIYGEFDNSSTLFTLQNLQILNLSDNNFSSEIPSGFNKLKNLTYLNLSHAGFVGQIPTEISYLARLVTLDISSVSYLYGQPLKLENIDLQMLVQNLTMLRQLYMDGVIVTTQGNKWSNALFKLVNLQELSMSNCNLSGPLDPSLTRLQNLSVIRLDQNNFSSPVPETFANFTNLTTLHLSSCELTGTFPEKIFQVATLSVVDLSFNYNLYGSLLEFPLNSPLQTLIVSGTSFSGGIPPSINNLGQLSILDLSNCHFNGTLPSSMSRLRELTYLDLSLNDFTGQIPSLNMSKNLTHLHFWKNGFTGSITSYHFGGLRNLLQIDLQDNFLDGSLPSSLFSLPLLRSIRLSNNNFQDQLNKFSNISSSKLEILDLSGNDLNGSIPTDIFQLRSLCVLELSSNKLNGRLKLDVIHRLVNLSTLGLSHNHLSIDTNFADVGLISSIPNMKIVELASCNLTEFPSFLRNQSKITTLDLSSNNIQGSIPTWIWQLNSLVQLNLSHNLLSNLEGPVQNPSSNLRLLDLHDNHLQGKLQIFPVHASYLDYSSNNFSFTIPSDIGNFLSSTIFLSLSKNNLSGNIPQSLCSSSSMLVLDFSYNHLNGKIPECLTQSERLVVLDLQHNKFYGSIPDKFPVSCVLRTLDLNSNLLWGSIPKSLANCTSLEVLDLGNNQVDDGFPCFLKTISTLRVMVLRGNKFHGHVGCPYSNSTWYMLQIVDLSVNNFSGVLPKNCFKTWKAMMLDEDDDGSKFNHIASQVLKFGGIYYQGSVTLTSKGLQMEFVNILTGFTSVDFSSNNFEGTIPEELMNFTRLNLLDLSDNALAGQIPSSIGNLKQLEALDLSSNHFDGEIPTQLANLNFLSYLDLSSNRLVGKIPVGIQLQTFDASSFVGNAELCGAPLPKNCSNETYGLPCTFGWNIIMVELGFVFGLALVIDPLLFWKQWRQWY

Gene3D: G3DSA:3.80.10.10
34-297 G3DSA:3.80.10.10

EDQQQSLLKLKNSLKFKTNKSTKLVSWNPTVDFCEWRGVACDEERQVTGLDLSGESIYGEFDNSSTLFTLQNLQILNLSDNNFSSEIPSGFNKLKNLTYLNLSHAGFVGQIPTEISYLARLVTLDISSVSYLYGQPLKLENIDLQMLVQNLTMLRQLYMDGVIVTTQGNKWSNALFKLVNLQELSMSNCNLSGPLDPSLTRLQNLSVIRLDQNNFSSPVPETFANFTNLTTLHLSSCELTGTFPEKIFQVATLSVVDLSFNYNL

HMMPfam: PF08263
IPR013210
34-75 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

EDQQQSLLKLKNSLKFKTNKSTKLVSWNPTVDFCEWRGVACD

superfamily: SSF52047
60-345 SSF52047,LRR

WNPTVDFCEWRGVACDEERQVTGLDLSGESIYGEFDNSSTLFTLQNLQILNLSDNNFSSEIPSGFNKLKNLTYLNLSHAGFVGQIPTEISYLARLVTLDISSVSYLYGQPLKLENIDLQMLVQNLTMLRQLYMDGVIVTTQGNKWSNALFKLVNLQELSMSNCNLSGPLDPSLTRLQNLSVIRLDQNNFSSPVPETFANFTNLTTLHLSSCELTGTFPEKIFQVATLSVVDLSFNYNLYGSLLEFPLNSPLQTLIVSGTSFSGGIPPSINNLGQLSILDLSNCHFN

HMMPfam: PF13855
98-137 LRR_8,Leucine rich repeat

STLFTLQNLQILNLSDNNFSSEIPSGFNKLKNLTYLNLSH

ProfileScan: PS51450
105-128 LRR,Leucine-rich repeat profile.

NLQILNLSDNNFSSEIPSGFNKLK

ProfileScan: PS51450
129-151 LRR,Leucine-rich repeat profile.

NLTYLNLSHAGFVGQIPTEISYL

ProfileScan: PS51450
213-233 LRR,Leucine-rich repeat profile.

NLQELSMSNCNLSGPLDPSLT

HMMPfam: PF13855
213-272 LRR_8,Leucine rich repeat

NLQELSMSNCNLSGPLDPSLTRLQNLSVIRLDQNNFSSPVPETFANFTNLTTLHLSSCEL

ProfileScan: PS51450
237-258 LRR,Leucine-rich repeat profile.

NLSVIRLDQNNFSSPVPETFAN

ProfileScan: PS51450
261-283 LRR,Leucine-rich repeat profile.

NLTTLHLSSCELTGTFPEKIFQV

Gene3D: G3DSA:3.80.10.10
308-505 G3DSA:3.80.10.10

SPLQTLIVSGTSFSGGIPPSINNLGQLSILDLSNCHFNGTLPSSMSRLRELTYLDLSLNDFTGQIPSLNMSKNLTHLHFWKNGFTGSITSYHFGGLRNLLQIDLQDNFLDGSLPSSLFSLPLLRSIRLSNNNFQDQLNKFSNISSSKLEILDLSGNDLNGSIPTDIFQLRSLCVLELSSNKLNGRLKLDVIHRLVNLS

HMMPfam: PF00560
IPR001611
333-354 LRR_1
Leucine-rich repeat

QLSILDLSNCHFNGTLPSSMSR

superfamily: SSF52047
347-614 SSF52047,LRR

TLPSSMSRLRELTYLDLSLNDFTGQIPSLNMSKNLTHLHFWKNGFTGSITSYHFGGLRNLLQIDLQDNFLDGSLPSSLFSLPLLRSIRLSNNNFQDQLNKFSNISSSKLEILDLSGNDLNGSIPTDIFQLRSLCVLELSSNKLNGRLKLDVIHRLVNLSTLGLSHNHLSIDTNFADVGLISSIPNMKIVELASCNLTEFPSFLRNQSKITTLDLSSNNIQGSIPTWIWQLNSLVQLNLSHNLLSNLEGPVQNPSSNLRLLDLHDNHLQ

ProfileScan: PS51450
357-379 LRR,Leucine-rich repeat profile.

ELTYLDLSLNDFTGQIPSLNMSK

ProfileScan: PS51450
405-427 LRR,Leucine-rich repeat profile.

NLLQIDLQDNFLDGSLPSSLFSL

ProfileScan: PS51450
429-451 LRR,Leucine-rich repeat profile.

LLRSIRLSNNNFQDQLNKFSNIS

HMMPfam: PF13855
453-514 LRR_8,Leucine rich repeat

SKLEILDLSGNDLNGSIPTDIFQLRSLCVLELSSNKLNGRLKLDVIHRLVNLSTLGLSHNHL

ProfileScan: PS51450
454-476 LRR,Leucine-rich repeat profile.

KLEILDLSGNDLNGSIPTDIFQL

ProfileScan: PS51450
478-499 LRR,Leucine-rich repeat profile.

SLCVLELSSNKLNGRLKLDVIH

ProfileScan: PS51450
503-524 LRR,Leucine-rich repeat profile.

NLSTLGLSHNHLSIDTNFADVG

Gene3D: G3DSA:3.80.10.10
506-615 G3DSA:3.80.10.10

TLGLSHNHLSIDTNFADVGLISSIPNMKIVELASCNLTEFPSFLRNQSKITTLDLSSNNIQGSIPTWIWQLNSLVQLNLSHNLLSNLEGPVQNPSSNLRLLDLHDNHLQG

HMMPfam: PF13855
530-589 LRR_8,Leucine rich repeat

PNMKIVELASCNLTEFPSFLRNQSKITTLDLSSNNIQGSIPTWIWQLNSLVQLNLSHNLL

ProfileScan: PS51450
554-576 LRR,Leucine-rich repeat profile.

KITTLDLSSNNIQGSIPTWIWQL

ProfileScan: PS51450
578-599 LRR,Leucine-rich repeat profile.

SLVQLNLSHNLLSNLEGPVQNP

ProfileScan: PS51450
602-624 LRR,Leucine-rich repeat profile.

NLRLLDLHDNHLQGKLQIFPVHA

superfamily: SSF52058
622-983 SSF52058,LRR

VHASYLDYSSNNFSFTIPSDIGNFLSSTIFLSLSKNNLSGNIPQSLCSSSSMLVLDFSYNHLNGKIPECLTQSERLVVLDLQHNKFYGSIPDKFPVSCVLRTLDLNSNLLWGSIPKSLANCTSLEVLDLGNNQVDDGFPCFLKTISTLRVMVLRGNKFHGHVGCPYSNSTWYMLQIVDLSVNNFSGVLPKNCFKTWKAMMLDEDDDGSKFNHIASQVLKFGGIYYQGSVTLTSKGLQMEFVNILTGFTSVDFSSNNFEGTIPEELMNFTRLNLLDLSDNALAGQIPSSIGNLKQLEALDLSSNHFDGEIPTQLANLNFLSYLDLSSNRLVGKIPVGIQLQTFDASSFVGNAELCGAPLPKNC

Gene3D: G3DSA:3.80.10.10
626-813 G3DSA:3.80.10.10

YLDYSSNNFSFTIPSDIGNFLSSTIFLSLSKNNLSGNIPQSLCSSSSMLVLDFSYNHLNGKIPECLTQSERLVVLDLQHNKFYGSIPDKFPVSCVLRTLDLNSNLLWGSIPKSLANCTSLEVLDLGNNQVDDGFPCFLKTISTLRVMVLRGNKFHGHVGCPYSNSTWYMLQIVDLSVNNFSGVLPKNC

ProfileScan: PS51450
653-674 LRR,Leucine-rich repeat profile.

SLSKNNLSGNIPQSLCSSSSML

ProfileScan: PS51450
696-718 LRR,Leucine-rich repeat profile.

RLVVLDLQHNKFYGSIPDKFPVS

ProfileScan: PS51450
720-743 LRR,Leucine-rich repeat profile.

VLRTLDLNSNLLWGSIPKSLANCT

HMMPfam: PF12799
721-757 LRR_4,Leucine Rich repeats (2 copies)

LRTLDLNSNLLWGSIPKSLANCTSLEVLDLGNNQVDD

ProfileScan: PS51450
744-764 LRR,Leucine-rich repeat profile.

SLEVLDLGNNQVDDGFPCFLK

Gene3D: G3DSA:3.80.10.10
866-958 G3DSA:3.80.10.10

TGFTSVDFSSNNFEGTIPEELMNFTRLNLLDLSDNALAGQIPSSIGNLKQLEALDLSSNHFDGEIPTQLANLNFLSYLDLSSNRLVGKIPVGI

ProfileScan: PS51450
891-913 LRR,Leucine-rich repeat profile.

RLNLLDLSDNALAGQIPSSIGNL

HMMPfam: PF13855
891-950 LRR_8,Leucine rich repeat

RLNLLDLSDNALAGQIPSSIGNLKQLEALDLSSNHFDGEIPTQLANLNFLSYLDLSSNRL

ProfileScan: PS51450
915-938 LRR,Leucine-rich repeat profile.

QLEALDLSSNHFDGEIPTQLANLN

ProfileScan: PS51450
939-961 LRR,Leucine-rich repeat profile.

FLSYLDLSSNRLVGKIPVGIQLQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox