PRGDB00061578 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 116047830 (CM000348)
Gene Class Unknown
Domain Type
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa linkage group XII, whole genome shotgun sequence.

DNA Sequence

AGTGAAAGAGCCAGACTGTGCATTCATGCTGCTGAAGCGTTAGAGAAGCAGAAGTTGAGGAACCAGGCATCAATTGAAGAAAAGCAGAAAGATATTGAGAAATGTTTAGATAAGCTAGAAGCGTACAAAAAGAAGGGTGCACTCAAAGTTGGCTATTATGATGCCTTCAAGAGTTCAGAACAAAAGGAGGATTTCCATGCTAATGTAGAGAGGCTTGAGCTAGCAGGTATATGGGATGAAATAATAGAAATGCTGAAAAGGAATGAACTCCCCGATGAGTTTGAGGGCCGGAAGACATGGATAGATCTTGGTACCAGGTATCGTCGCATTGTTGAACCCTTGGATATTGCTAATTACTATCGACACCTCAAGAATGAAGACACAGGGCCCTATATGGGAAAGGGCAGGCCAAGACGGTATAAATGCACCCAAAGATGGCGGGAGCATGCTGAGCGATTGCCGCATGAAGTTCCAGGATCCTGTTTTTGGGCTGAGGTAGAGGAACTGTGCATTAAAACAAGCTGCCAGGGAATTAAAGAAAGCATTTCTCACCTAAATACCAAAGTCAAAAAGTGGATTAAAGATGGGGAACTGGGTGTTGATGTTCTGTTGGAGAATTCCACCTTTAATAAATTGCTGAAACAACATTTCCTGACAAACTTTTCTCAGGATCTTGACCTAAGGAAGGAGTTGCATGTGCAGGGATTTGCAGATGCGTAAGTGGAAAAAGCTGCGACAGACAGGAGGCAAATTGTATTTACAGGCCACTCTTCAGGAGGGGCAATTGCCATACTGGCAACAATTTGGTTCTTGGAAGAGCAAATTAGAAAAAGCTCCAACTGGATTGCGCCACTCTGTCTGACTTTTGGATCTCCACTTGTTGGTGATCGCATTATAAACCTTGCACTTAGGCGTGAAAACTGGTCTCGCTACTTTGTGAATTTCGTTATGAGATGCGACATTGTTCCTCAGATTTCACTCAGTCCACTCTCTTCCATTAATCAAAAACTGCAGCAAGTTCTTGATTACTTTAATCAAAAAGCGCAACAACCTCCTAATGAAGCTCCAGCTTTCTATGTAACTGTGGTGAAAAATGCATCGTCTGTTGCTAATTATGCTGCCTGTAAGATCATGGGAAGCACGAATCCTTTATTGGAGACTATATCAAGTTTCATTGAACTGAGTCCTTACAGACCCTTAGGGACCTATGTTTTCTGCACAGGAAATGGGAAACTTGTTGTCTCAAGTAACCCAGATGCTGTGCTGCAAGTACTGTACTATGCCTCCCAGTTGAGCACTGGAGAAGCAAGAGAAAAAGTTGAAGTTGCCCAAACAAGCCTAAGAGATCATTTGAACTACGGAAATGACTTGCAAGAATACTTAAAAATGTCAATTGTAACATGTTTATATCAGCATCATCCAGAAGCACTTCCGTTATCTTCGAATGTTGGAAATGTTGAGCGTGGGAGAGTTGATGTGGCCTTGAATGACCTAGGCCTGATGGGTACTGTCAAGCTTGGAGAGAACATGGAGATCAAAGAAGTGGTTATCCAGAAAGCATGCTCAATGGCCATGAATGCTCACAAATCTCCAGAGAAGCAATATCTTTCTAAAAAGATTAGAACTTCATCATCTGAAGTTGTCTTTAGCTTTCCTGGATCTTGGTCTGTAAATGATTGGTTTGCTGGAACTTCCTTTGGAGAAACGAAGATGGATCCTCAGCTCTTTCCTTCTCTCAAATATGTTGGTCTTGATGTAACTGCTACTGTAAACGAAGTCTTTCTCAATAGATTCAAAGCAGTTTTGGCTAATCCACAGTTCCAAATTGAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Populus trichocarpa].

MGTVKLGENMEIKEVVIQKACSMAMNAHKSPEKQYLSKKIRTSSSEVVFSFPGSWSVNDWFAGTSFGETKMDPQLFPSLKYVGLDVTATVNEVFLNRFKAVLANPQFQIEVEKAATDRRQIVFTGHSSGGAIAILATIWFLEEQIRKSSNWIAPLCLTFGSPLVGDRIINLALRRENWSRYFVNFVMRCDIVPQISLSPLSSINQKLQQVLDYFNQKAQQPPNEAPAFYVTVVKNASSVANYAACKIMGSTNPLLETISSFIELSPYRPLGTYVFCTGNGKLVVSSNPDAVLQVLYYASQLSTGEAREKVEVAQTSLRDHLNYGNDLQEYLKMSIVTCLYQHHPEALPLSSNVGNVERGRVDVALNDLGLSERARLCIHAAEALEKQKLRNQASIEEKQKDIEKCLDKLEAYKKKGALKVGYYDAFKSSEQKEDFHANVERLELAGIWDEIIEMLKRNELPDEFEGRKTWIDLGTRYRRIVEPLDIANYYRHLKNEDTGPYMGKGRPRRYKCTQRWREHAERLPHEVPGSCFWAEVEELCIKTSCQGIKESISHLNTKVKKWIKDGELGVDVLLENSTFNKLLKQHFLTNFSQDLDLRKELHVQGFADA

Domains

Domain Start-End Description Sequence

superfamily: SSF53474
42-197 SSF53474

TSSSEVVFSFPGSWSVNDWFAGTSFGETKMDPQLFPSLKYVGLDVTATVNEVFLNRFKAVLANPQFQIEVEKAATDRRQIVFTGHSSGGAIAILATIWFLEEQIRKSSNWIAPLCLTFGSPLVGDRIINLALRRENWSRYFVNFVMRCDIVPQISL

Gene3D: G3DSA:3.40.50.1820
42-199 G3DSA:3.40.50.1820

TSSSEVVFSFPGSWSVNDWFAGTSFGETKMDPQLFPSLKYVGLDVTATVNEVFLNRFKAVLANPQFQIEVEKAATDRRQIVFTGHSSGGAIAILATIWFLEEQIRKSSNWIAPLCLTFGSPLVGDRIINLALRRENWSRYFVNFVMRCDIVPQISLSP

HMMPfam: PF01764
IPR002921
48-196 Lipase_3
Lipase, class 3

VFSFPGSWSVNDWFAGTSFGETKMDPQLFPSLKYVGLDVTATVNEVFLNRFKAVLANPQFQIEVEKAATDRRQIVFTGHSSGGAIAILATIWFLEEQIRKSSNWIAPLCLTFGSPLVGDRIINLALRRENWSRYFVNFVMRCDIVPQIS

PatternScan: PS00120
121-130 LIPASE_SER,Lipases

IVFTGHSSGG

Gene3D: G3DSA:3.40.50.1820
265-324 G3DSA:3.40.50.1820

SPYRPLGTYVFCTGNGKLVVSSNPDAVLQVLYYASQLSTGEAREKVEVAQTSLRDHLNYG


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox