PRGDB00061585 (TIR-NBS class disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS class disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 332002898 (CP002688)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 5, complete sequence.

DNA Sequence

ATGTCTTCCTCTTCTTCCTCTTCCAGTCAGAAATTCTACGTTTTTCTGAGCTTCCAAGGCCTGGACACCCGTAGAACCTTTGTCAGCCATCTCCGCCGTTCATTGGACAGAAAAGGCATTAAGACTTTTGAAGATGAAAATGAGTCTCTGAGAGGTGAATTAGATTCTTCTGCGGTCTATCAGACAATTGGAGAGTCAAAAGTGGCCGTTGTCTTGATATCGGTGAACTATGCCTCTTCACCTTTGTGCCTGGATAGTCTCCTTAAGATTTTGAAGTTTCACCAGTCAGGTTCACTCGTTTTGATACCAATCTTCTATGAAGTTGATCCTATGGATGTAAGAAAACAAATTGGGAAACTGTACGAAGCATTCTCATTGCATGAGAGAGAAAACCCTGAAAAGGTTCAAACATGGAGGCAAGCACTGTCCCAACTGGTCAGCATTCCGGGCGGCCAGTACTCAGAGATTTGGGATGGTGATGCAGAGCTGATCCATCAAATTACCGTTGACATATGGAATATATTTGTCGCTTCCAAGTCAAGTGATTTGTGTGGTCTTGTGGGGATGGATCGCCACATGAAAGCCATGTATAGATTGTTAGATTTAGGATTGAAAGATGAAGTTCGTCATATCAAAATTTGGGGTAGCCGAGACATCGGCAAGACTGAGTTTGCAAAATATCTGTATGAAGAGATTTTGCACAACTTTGATACCCATGTCATGTTAAAAGCTCCACAAAGAATTTCGCGTTTTGAGGAGGTTCGTTTGGCAGAATATGTGTGTCTTCGACTTGAGAAAGCAAGAACTTTGTCAAAAACATCGAAGGACACTGCATCAAGGTTTCTCCTCGTACTGGATAATGTGAATGAATCATTTGACCCAATAAGAAAACTTGCAAGGGTGATTAGTTCTTTTGGTCCAGGGAGCAGGATCATTACAACCACCCGAAACTTGCAGTTCAGTTCGACTTCCCCTTTACCGTTTCAATATGAAGTTTTAGGGCTGGAGTTCTCTGAAGCTCTTCAGCTCTTCTGTCTCCATGCTTTCGAGCAGACTCATCCTTTTCTTGGTTTTGAAGACCTTTCATGTCGTGCAGTGAAACTCGCAGGTGGTTTTCCTTTATCCTTAAAAAGATTAGGCTCCAGATTTTCTGGTAGAAAGAAGGATGAATGGGAAGTGATCTTGTTTGGATACGAAAGATCAACTGTTAACGGTGTTATAAATCCCGAAAAAAATAGCCTGGATGGGCTATACGAATACAGCTCTATCATGGAAACTTTTTCAAGTCAACCGATTTCAAGCACAACAAGAAGTTTTGAAGACCTTGTGGGGATGAATCATCGTATGCAAGCTTTGTCGGCATTGTTAGAGCTAGAATCCGACAAAGAAGTTCGTGTAGTTGGAATTTGGGGTACAGGAGGCATTGGTAAAACAACTCTATCAAGATATGCTTACGAGAGAATCTCGCAGCAATTCCACACCCATGCTTTTCTAGAAAATGCTCAAGAGAGCAGTTCATCCTGTCTAGAAGAACGGTTTCTATCCAAAGCTATCCAAAGAGAAGCGCTTGCAGTAAGGAACTCTAAAGACTGTCCAGAAATAATGAAATCATTGATTCAACACCGAAAAGTTCTGCTTATAGTTGATGATGTGGATAACGTCAAGACGTTAGAGGAAGTCTTCAAGATCACCAGTTGGTTGGTCCCTGGAAGTAGAGTTATTGTGACTGCACGAGATGAGAGTTTTCTTCTGGCCAGTGGAGTGAAATATATTTTTGAAGTTAAGGGCCTGAGATTTGACCAAGCTCTTCAACTTTTCTATCAATTCGCTTTCAAGCAGAAATCACCTCCGGTTCGTGTTTTGAAGAAAAGCAGAATAAAGGTACAATTTGAGTACCAGTCGAATAGCCATGGCAAGTAG


Protein sequences

Name Description Sequence
TIR-NBS class disease resistance protein TIR-NBS class disease resistance protein [Arabidopsis thaliana].

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPGGQYSEIWDGDAELIHQITVDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRVLKKSRIKVQFEYQSNSHGK

TIR-NBS class disease resistance protein TIR-NBS class disease resistance protein [Arabidopsis thaliana].

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPGGQYSEIWDGDAELIHQITVDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRVLKKSRIKVQFEYQSNSHGK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPG

superfamily: SSF52200
IPR000157
1-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPG

Gene3D: G3DSA:3.40.50.10140
8-145 G3DSA:3.40.50.10140

SSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQL

Gene3D: G3DSA:3.40.50.10140
8-145 G3DSA:3.40.50.10140

SSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQL

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll-Interleukin receptor

QKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll-Interleukin receptor

QKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll-Interleukin receptor

VFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALS

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll-Interleukin receptor

VFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALS

superfamily: SSF52540
169-406 SSF52540

VDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGV

superfamily: SSF52540
169-406 SSF52540

VDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGV

HMMPfam: PF00931
IPR002182
194-396 NB-ARC,NBS
NB-ARC

KAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILF

HMMPfam: PF00931
IPR002182
194-396 NB-ARC,NBS
NB-ARC

KAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILF

HMMPanther: PTHR11017
292-617 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPP

HMMPanther: PTHR11017:SF20
292-617 PTHR11017:SF20,SUBFAMILY NOT NAMED

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPP

HMMPanther: PTHR11017:SF20
292-617 PTHR11017:SF20,SUBFAMILY NOT NAMED

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPP

HMMPanther: PTHR11017
292-617 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPP

superfamily: SSF52540
424-625 SSF52540

METFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRVLKKSR

superfamily: SSF52540
424-625 SSF52540

METFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRVLKKSR

Gene3D: G3DSA:3.40.50.300
436-578 G3DSA:3.40.50.300

TRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTAR

Gene3D: G3DSA:3.40.50.300
436-578 G3DSA:3.40.50.300

TRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTAR

HMMPfam: PF00931
IPR002182
454-614 NB-ARC,NBS
NB-ARC

ALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQK

HMMPfam: PF00931
IPR002182
454-614 NB-ARC,NBS
NB-ARC

ALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQK

FPrintScan: PR00364
IPR000767
466-481 DISEASERSIST
Disease resistance protein

VVGIWGTGGIGKTTLS

FPrintScan: PR00364
IPR000767
466-481 DISEASERSIST
Disease resistance protein

VVGIWGTGGIGKTTLS

FPrintScan: PR00364
IPR000767
538-552 DISEASERSIST
Disease resistance protein

LIQHRKVLLIVDDVD

FPrintScan: PR00364
IPR000767
538-552 DISEASERSIST
Disease resistance protein

LIQHRKVLLIVDDVD


List of References

S Tabata, T Kaneko, Y Nakamura, H Kotani, T Kato, E Asamizu, N Miyajima, S Sasamoto, T Kimura, T Hosouchi, K Kawashima, M Kohara, M Matsumoto, A Matsuno, A Muraki, S Nakayama, N Nakazaki, K Naruo, S Okumura, S Shinpo, C Takeuchi, T Wada, A Watanabe, M Yamada, M Yasuda, S Sato, M de la Bastide, E Huang, L Spiegel, L Gnoj, A O'Shaughnessy, R Preston, K Habermann, J Murray, D Johnson, T Rohlfing, J Nelson, T Stoneking, K Pepin, J Spieth, M Sekhon, J Armstrong, M Becker, E Belter, H Cordum, M Cordes, L Courtney, W Courtney, M Dante, H Du, J Edwards, J Fryman, B Haakensen, E Lamar, P Latreille, S Leonard, R Meyer, E Mulvaney, P Ozersky, A Riley, C Strowmatt, C Wagner-McPherson, A Wollam, M Yoakum, M Bell, N Dedhia, L Parnell, R Shah, M Rodriguez, L H See, D Vil, J Baker, K Kirchoff, K Toth, L King, A Bahret, B Miller, M Marra, R Martienssen, W R McCombie, R K Wilson, G Murphy, I Bancroft, G Volckaert, R Wambutt, A Düsterhöft, W Stiekema, T Pohl, K D Entian, N Terryn, N Hartley, E Bent, S Johnson, S A Langham, B McCullagh, J Robben, B Grymonprez, W Zimmermann, U Ramsperger, H Wedler, K Balke, E Wedler, S Peters, M van Staveren, W Dirkse, P Mooijman, R K Lankhorst, T Weitzenegger, G Bothe, M Rose, J Hauf, S Berneiser, S Hempel, M Feldpausch, S Lamberth, R Villarroel, J Gielen, W Ardiles, O Bents, K Lemcke, G Kolesov, K Mayer, S Rudd, H Schoof, C Schueller, P Zaccaria, H W Mewes, M Bevan, P Fransz, Kazusa DNA Research Institute, Cold Spring Harbor and Washington University in St Louis Sequencing Consortium, European Union Arabidopsis Genome Sequencing Consortium
Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana.
Nature: 2000, 408(6814);823-6
PubMed:11130714 WorldCat.org DOI (P p)

S Tabata, T Kaneko, Y Nakamura, H Kotani, T Kato, E Asamizu, N Miyajima, S Sasamoto, T Kimura, T Hosouchi, K Kawashima, M Kohara, M Matsumoto, A Matsuno, A Muraki, S Nakayama, N Nakazaki, K Naruo, S Okumura, S Shinpo, C Takeuchi, T Wada, A Watanabe, M Yamada, M Yasuda, S Sato, M de la Bastide, E Huang, L Spiegel, L Gnoj, A O'Shaughnessy, R Preston, K Habermann, J Murray, D Johnson, T Rohlfing, J Nelson, T Stoneking, K Pepin, J Spieth, M Sekhon, J Armstrong, M Becker, E Belter, H Cordum, M Cordes, L Courtney, W Courtney, M Dante, H Du, J Edwards, J Fryman, B Haakensen, E Lamar, P Latreille, S Leonard, R Meyer, E Mulvaney, P Ozersky, A Riley, C Strowmatt, C Wagner-McPherson, A Wollam, M Yoakum, M Bell, N Dedhia, L Parnell, R Shah, M Rodriguez, L H See, D Vil, J Baker, K Kirchoff, K Toth, L King, A Bahret, B Miller, M Marra, R Martienssen, W R McCombie, R K Wilson, G Murphy, I Bancroft, G Volckaert, R Wambutt, A Düsterhöft, W Stiekema, T Pohl, K D Entian, N Terryn, N Hartley, E Bent, S Johnson, S A Langham, B McCullagh, J Robben, B Grymonprez, W Zimmermann, U Ramsperger, H Wedler, K Balke, E Wedler, S Peters, M van Staveren, W Dirkse, P Mooijman, R K Lankhorst, T Weitzenegger, G Bothe, M Rose, J Hauf, S Berneiser, S Hempel, M Feldpausch, S Lamberth, R Villarroel, J Gielen, W Ardiles, O Bents, K Lemcke, G Kolesov, K Mayer, S Rudd, H Schoof, C Schueller, P Zaccaria, H W Mewes, M Bevan, P Fransz, Kazusa DNA Research Institute, Cold Spring Harbor and Washington University in St Louis Sequencing Consortium, European Union Arabidopsis Genome Sequencing Consortium
Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana.
Nature: 2000, 408(6814);823-6
PubMed:11130714 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox