PRGDB00061592 (TIR-NBS class disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS class disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 334188266 (NM_001203565)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana TIR-NBS class disease resistance protein (AT5G48780) mRNA, complete cds.

DNA Sequence

ATGTCTTCCTCTTCTTCCTCTTCCAGTCAGAAATTCTACGTTTTTCTGAGCTTCCAAGGCCTGGACACCCGTAGAACCTTTGTCAGCCATCTCCGCCGTTCATTGGACAGAAAAGGCATTAAGACTTTTGAAGATGAAAATGAGTCTCTGAGAGGTGAATTAGATTCTTCTGCGGTCTATCAGACAATTGGAGAGTCAAAAGTGGCCGTTGTCTTGATATCGGTGAACTATGCCTCTTCACCTTTGTGCCTGGATAGTCTCCTTAAGATTTTGAAGTTTCACCAGTCAGGTTCACTCGTTTTGATACCAATCTTCTATGAAGTTGATCCTATGGATGTAAGAAAACAAATTGGGAAACTGTACGAAGCATTCTCATTGCATGAGAGAGAAAACCCTGAAAAGGTTCAAACATGGAGGCAAGCACTGTCCCAACTGGTCAGCATTCCGGGCGGCCAGTACTCAGAGATTTGGGATGGTGATGCAGAGCTGATCCATCAAATTACCGTTGACATATGGAATATATTTGTCGCTTCCAAGTCAAGTGATTTGTGTGGTCTTGTGGGGATGGATCGCCACATGAAAGCCATGTATAGATTGTTAGATTTAGGATTGAAAGATGAAGTTCGTCATATCAAAATTTGGGGTAGCCGAGACATCGGCAAGACTGAGTTTGCAAAATATCTGTATGAAGAGATTTTGCACAACTTTGATACCCATGTCATGTTAAAAGCTCCACAAAGAATTTCGCGTTTTGAGGAGGTTCGTTTGGCAGAATATGTGTGTCTTCGACTTGAGAAAGCAAGAACTTTGTCAAAAACATCGAAGGACACTGCATCAAGGTTTCTCCTCGTACTGGATAATGTGAATGAATCATTTGACCCAATAAGAAAACTTGCAAGGGTGATTAGTTCTTTTGGTCCAGGGAGCAGGATCATTACAACCACCCGAAACTTGCAGTTCAGTTCGACTTCCCCTTTACCGTTTCAATATGAAGTTTTAGGGCTGGAGTTCTCTGAAGCTCTTCAGCTCTTCTGTCTCCATGCTTTCGAGCAGACTCATCCTTTTCTTGGTTTTGAAGACCTTTCATGTCGTGCAGTGAAACTCGCAGGTGGTTTTCCTTTATCCTTAAAAAGATTAGGCTCCAGATTTTCTGGTAGAAAGAAGGATGAATGGGAAGTGATCTTGTTTGGATACGAAAGATCAACTGTTAACGGTGTTATAAATCCCGAAAAAAATAGCCTGGATGGGCTATACGAATACAGCTCTATCATGGAAACTTTTTCAAGTCAACCGATTTCAAGCACAACAAGAAGTTTTGAAGACCTTGTGGGGATGAATCATCGTATGCAAGCTTTGTCGGCATTGTTAGAGCTAGAATCCGACAAAGAAGTTCGTGTAGTTGGAATTTGGGGTACAGGAGGCATTGGTAAAACAACTCTATCAAGATATGCTTACGAGAGAATCTCGCAGCAATTCCACACCCATGCTTTTCTAGAAAATGCTCAAGAGAGCAGTTCATCCTGTCTAGAAGAACGGTTTCTATCCAAAGCTATCCAAAGAGAAGCGCTTGCAGTAAGGAACTCTAAAGACTGTCCAGAAATAATGAAATCATTGATTCAACACCGAAAAGTTCTGCTTATAGTTGATGATGTGGATAACGTCAAGACGTTAGAGGAAGTCTTCAAGATCACCAGTTGGTTGGTCCCTGGAAGTAGAGTTATTGTGACTGCACGAGATGAGAGTTTTCTTCTGGCCAGTGGAGTGAAATATATTTTTGAAGTTAAGGGCCTGAGATTTGACCAAGCTCTTCAACTTTTCTATCAATTCGCTTTCAAGCAGAAATCACCTCCGGTTCGTGTTTTGAAGAAAAGCAGAATAAAGGTACAATTTGAGTACCAGTCGAATAGCCATGGCAAGTAG


Protein sequences

Name Description Sequence
TIR-NBS class disease resistance protein TIR-NBS class disease resistance protein [Arabidopsis thaliana].

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPGGQYSEIWDGDAELIHQITVDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRVLKKSRIKVQFEYQSNSHGK

TIR-NBS class disease resistance protein TIR-NBS class disease resistance protein [Arabidopsis thaliana].

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPGGQYSEIWDGDAELIHQITVDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRVLKKSRIKVQFEYQSNSHGK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPG

superfamily: SSF52200
IPR000157
1-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPG

Gene3D: G3DSA:3.40.50.10140
8-145 G3DSA:3.40.50.10140

SSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQL

Gene3D: G3DSA:3.40.50.10140
8-145 G3DSA:3.40.50.10140

SSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQL

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll-Interleukin receptor

QKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll-Interleukin receptor

QKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll-Interleukin receptor

VFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALS

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll-Interleukin receptor

VFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALS

superfamily: SSF52540
169-406 SSF52540

VDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGV

superfamily: SSF52540
169-406 SSF52540

VDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGV

HMMPfam: PF00931
IPR002182
194-396 NB-ARC,NBS
NB-ARC

KAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILF

HMMPfam: PF00931
IPR002182
194-396 NB-ARC,NBS
NB-ARC

KAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILF

HMMPanther: PTHR11017:SF20
292-617 PTHR11017:SF20,SUBFAMILY NOT NAMED

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPP

HMMPanther: PTHR11017
292-617 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPP

HMMPanther: PTHR11017:SF20
292-617 PTHR11017:SF20,SUBFAMILY NOT NAMED

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPP

HMMPanther: PTHR11017
292-617 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPP

superfamily: SSF52540
424-625 SSF52540

METFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRVLKKSR

superfamily: SSF52540
424-625 SSF52540

METFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRVLKKSR

Gene3D: G3DSA:3.40.50.300
436-578 G3DSA:3.40.50.300

TRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTAR

Gene3D: G3DSA:3.40.50.300
436-578 G3DSA:3.40.50.300

TRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTAR

HMMPfam: PF00931
IPR002182
454-614 NB-ARC,NBS
NB-ARC

ALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQK

HMMPfam: PF00931
IPR002182
454-614 NB-ARC,NBS
NB-ARC

ALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQK

FPrintScan: PR00364
IPR000767
466-481 DISEASERSIST
Disease resistance protein

VVGIWGTGGIGKTTLS

FPrintScan: PR00364
IPR000767
466-481 DISEASERSIST
Disease resistance protein

VVGIWGTGGIGKTTLS

FPrintScan: PR00364
IPR000767
538-552 DISEASERSIST
Disease resistance protein

LIQHRKVLLIVDDVD

FPrintScan: PR00364
IPR000767
538-552 DISEASERSIST
Disease resistance protein

LIQHRKVLLIVDDVD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox