PRGDB00061595 (TIR-NBS-LRR class disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR class disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 334183666 (NM_001198396)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana TIR-NBS-LRR class disease resistance protein (AT1G65850) mRNA, complete cds.

DNA Sequence

ATGACATCCATGATAGCTTCTCGCCAACAGAGTCAACGCTCCTGTCCAATATGCGCAACACCTTATTACAACAAAATACTTGATTCTTCTACTATATCTTCTTCATCAGTTCCTTCATCATCTTCGTCCCACAAGTGGACACATCAAGTCTTTCCAAGCTTCCGTGGGGAAGATGTACGTAGAGGTTTTCTCAGTCATATTCACAAGGAGTTTCAAAGAAAGGGAATTACACCATTCATTGATAATGAGATCAAGAGAGGAGAATCCATTGGTCTTGAAATCATACATGCGATTAGAGAATCTAAGATCGCGATTGTCTTGCTCTCTAGGAACTATGCTTCTTCATCTTGGTGTCTTGACGAGTTGGTGGAGATCATGAAATGCAAAGAAGAATTTAGTCAAATAGTGATCCCCATTTTCTATAGAGTGGATCCATCCGATGTTAAGAAGCTCACAGGAAATTTTGGGAATGTCTTCAAAAATAATTGTGTTGGTAAAACTAATGAGGTTATAAGGAAATGGAGACAAGCTCTGGCAAAAATGGGAACAACCACTGGTTACGATTCTCGCAACTGGGATAATGAAGCGACCATGATTGAAAACATTGCCACTGATATTTCGAATATGCTGAATTATTCTACGCCATCACGTGATTTTGACGGTTTAATTGGGATGAGAGCTCATATGAAAGTAATGGAACCGATGTTATGCCTACACTCCGATGAAGTGAGGATGATTGGAATTTGGGGTCCTTCTGGGATCGGGAAAACTACCATTGCTAGAATCTTATTTAGCCAATTTAGCGACAGTTTTGAATTGAGTGTCTTTATGGAGAATGTTAAGGAGTTAATGTATACAAGACCGGTGTGTTCTGATGAATACAGTGCAAAGTTACACTTACAGAAACAGTTCATGTCCCAGATTATCAACCACAAAGATATCGAGATTCCTCACCTAGGAGTTGTAGAAGATAGATTGAAAGACAAGAAAGTGTTTATTGTTCTTGATAATATCGACCAGTCAATACAACTAGATGCTATTGCAAAAGAAAGTCGATGGTTTGGTCATGGAAGTCGGATTATCATCACAACACAAGACCGGAAACTTTTGAAGGCACATGATGGCATCAACCATATTTACAACGTAAATTTTCCATCAGCATATGAAGCTTGCCAAATATTTTGTATGTATGCTTTTGGACAAAAATTTCCTAAAGATGGTTTCGAAGAGCTTGCATGGGAAGTTGCAAAACTTTTAGGTGGACTACCATTGGGTTTAAGAGTTATGGGCTCTCATTTTCGGGGAATGTCTAAACATGAGTGGATAAATGCCCTACCGAGGTTAAGGACTCGCCTTGATGCCAATATTCAAAGCATCTTAAAGTTTAGTTACAATGCCTTGTGTGAAGAAGATAAAGACTTATTTCTTTATATAGCATGCCTTTTCAACAATAAAAGGATTGAAAAAGTGGAAGAGCATCTTGCAGAGAAGTCCCTGAATGTGAAGCAAGGACTTCACGTTTTAACTGAAAAATCTCTCATATCTATTGAAGGGGGAAGAATAAAGATGCATAATTTGCTAGAACAATTGGGTAAAGAAATTGTTCGTCATGGGCTCGGGCATCAACCCATTCGTGAACCTGGGAAACGTCAATTTTTGGTTGATACTAGAGATATTTGTGAACTACTCACTAATGACACGGGTAGTAAAAGTGTTATAGGCATACATTTCTACTCATCCGAGCTCTCAAGCGAATTAAATATAAGTGAGAGAGCTTTTGAAGGAATGCCTAACCTTAAATTCTTAAGATTCTACTACCGCTATGGTGACGAGAGTGATAAATTGTACTTACCACAAGGTTTGAATTATCTATCTCAAAAACTTAAAATACTAGAATGGGATCATTTTCCGTTGACATGTATGCCTTCCAATTTTTGTACGGAGTACCTTGTTGAACTAAACATGCGGTTCAGCAAACTTCATAAGCTGTGGGAAGGAAACCGGCCGCTTGCAAACCTTAACTGGATGTATTTGAATCATTCGAAAATCCTAAAGGAGCTACCTGATCTCTCAACAGCCACGAACCTTCAAGAACTATTTCTCGTTAAATGCTCAAGTTTGGTGGAGCTCCCATCCTCTATCGGAAAAGCCACTAATCTCCAGAAACTGTATCTTAATATGTGCACGAGTTTGGTGGAGCTGCCCTCTTCTATTGGGAACCTTCATAAGTTACAAAAATTGACTTTGAATGGATGCTCAAAGCTAGAGGTTCTTCCAGCTAACATCAACTTGGAATCTCTTGATGAACTTGATCTCACTGATTGCTTGGTGTTGAAAAGATTTCCTGAGATCTCTACAAACATTAAAGTTCTCAAGCTCTTAAGAACTACAATAAAAGAAGTCCCTTCGTCAATTAAGTCATGGCCTCGTCTTCGCGATTTGGAATTGTCATACAATCAAAACCTCAAAGGATTCATGCATGCTCTTGATATCATCACGACGATGTACTTTAACGATATAGAAATGCAAGAAATTCCTTTGTGGGTCAAGAAAATCTCTAGGCTTCAGACACTTATACTCAACGGATGTAAGAAGCTGGTATCACTCCCACAGCTTCCGGATTCCTTATCATACCTAAAGGTAGTAAACTGTGAGTCACTGGAGAGACTTGATTGCTCATTTCATAATCCAAAGATGTCTCTTGGGTTTATTAACTGCCTCAAACTGAATAAAGAAGCAAAGGAACTCATCATCCAGATTACAACAAAGTGTACAGTCTTACCCGGTAGAGAGGTGCCAGTGTACTTCACTCATCGAACTAAAAATGGAAGTTCCTTGAGAGTAAATTTGAATCGAAGGCCTCTTTCTACAGCCTCGAGATTTAAGGCTTGCATCTTGCTGGTTAATAAATATTGCAAGGAGAATGAGGTGAAAGAGGTGTTTGGTAGAAAAATGATGAAGGCATCTTACTGCATCATAGATCTTGGTCTTGATGTTCAGTGCAGACCTACACACCACTTTCTACCTCCCTCTTTAACTGAGCATTTGTACATCTTTGACTTTGAAGCAGATGTGACATCCAACGAGCTTTTCTGTGACTTCCAAGTCGACAGTAACGAAATGGTTATAAAAGAATGTGGGATAATCCAACTTTAA


Protein sequences

Name Description Sequence
TIR-NBS-LRR class disease resistance protein TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana].

MTSMIASRQQSQRSCPICATPYYNKILDSSTISSSSVPSSSSSHKWTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCTVLPGREVPVYFTHRTKNGSSLRVNLNRRPLSTASRFKACILLVNKYCKENEVKEVFGRKMMKASYCIIDLGLDVQCRPTHHFLPPSLTEHLYIFDFEADVTSNELFCDFQVDSNEMVIKECGIIQL

TIR-NBS-LRR class disease resistance protein TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana].

MTSMIASRQQSQRSCPICATPYYNKILDSSTISSSSVPSSSSSHKWTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCTVLPGREVPVYFTHRTKNGSSLRVNLNRRPLSTASRFKACILLVNKYCKENEVKEVFGRKMMKASYCIIDLGLDVQCRPTHHFLPPSLTEHLYIFDFEADVTSNELFCDFQVDSNEMVIKECGIIQL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
36-187 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SVPSSSSSHKWTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGY

superfamily: SSF52200
IPR000157
36-187 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SVPSSSSSHKWTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGY

Gene3D: G3DSA:3.40.50.10140
44-181 G3DSA:3.40.50.10140

HKWTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKM

Gene3D: G3DSA:3.40.50.10140
44-181 G3DSA:3.40.50.10140

HKWTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKM

ProfileScan: PS50104
IPR000157
46-184 TIR
Toll-Interleukin receptor

WTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTT

ProfileScan: PS50104
IPR000157
46-184 TIR
Toll-Interleukin receptor

WTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTT

HMMSmart: SM00255
IPR000157
47-184 TIR
Toll/interleukin-1 receptor homology (TIR) domain

THQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTT

HMMSmart: SM00255
IPR000157
47-184 TIR
Toll/interleukin-1 receptor homology (TIR) domain

THQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTT

HMMPfam: PF01582
IPR000157
50-179 TIR
Toll-Interleukin receptor

VFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALA

HMMPfam: PF01582
IPR000157
50-179 TIR
Toll-Interleukin receptor

VFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALA

HMMPanther: PTHR11017:SF20
71-1051 PTHR11017:SF20,SUBFAMILY NOT NAMED

FQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCTVLPGREVPVYFTHRTKNGSSLRVNLNRRPLSTASRFKACILLVNKYCKENEVKEVFGRKMMKASYCIIDLGLDVQCRPTHHFLPPSLTEHLYIFDFEADVTSNELFCDFQVDSNEMVIKECGIIQL

HMMPanther: PTHR11017
71-1051 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCTVLPGREVPVYFTHRTKNGSSLRVNLNRRPLSTASRFKACILLVNKYCKENEVKEVFGRKMMKASYCIIDLGLDVQCRPTHHFLPPSLTEHLYIFDFEADVTSNELFCDFQVDSNEMVIKECGIIQL

HMMPanther: PTHR11017
71-1051 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCTVLPGREVPVYFTHRTKNGSSLRVNLNRRPLSTASRFKACILLVNKYCKENEVKEVFGRKMMKASYCIIDLGLDVQCRPTHHFLPPSLTEHLYIFDFEADVTSNELFCDFQVDSNEMVIKECGIIQL

HMMPanther: PTHR11017:SF20
71-1051 PTHR11017:SF20,SUBFAMILY NOT NAMED

FQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCTVLPGREVPVYFTHRTKNGSSLRVNLNRRPLSTASRFKACILLVNKYCKENEVKEVFGRKMMKASYCIIDLGLDVQCRPTHHFLPPSLTEHLYIFDFEADVTSNELFCDFQVDSNEMVIKECGIIQL

superfamily: SSF52540
101-476 SSF52540

SKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFL

superfamily: SSF52540
101-476 SSF52540

SKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFL

Gene3D: G3DSA:3.40.50.300
207-252 G3DSA:3.40.50.300

SNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPS

Gene3D: G3DSA:3.40.50.300
207-252 G3DSA:3.40.50.300

SNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPS

HMMPfam: PF00931
IPR002182
235-490 NB-ARC,NBS
NB-ARC

MLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKV

HMMPfam: PF00931
IPR002182
235-490 NB-ARC,NBS
NB-ARC

MLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKV

HMMSmart: SM00382
IPR003593
242-385 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFP

HMMSmart: SM00382
IPR003593
242-385 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFP

FPrintScan: PR00364
IPR000767
245-260 DISEASERSIST
Disease resistance protein

MIGIWGPSGIGKTTIA

FPrintScan: PR00364
IPR000767
245-260 DISEASERSIST
Disease resistance protein

MIGIWGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
253-370 G3DSA:3.40.50.300

GIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLL

Gene3D: G3DSA:3.40.50.300
253-370 G3DSA:3.40.50.300

GIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLL

FPrintScan: PR00364
IPR000767
325-339 DISEASERSIST
Disease resistance protein

RLKDKKVFIVLDNID

FPrintScan: PR00364
IPR000767
325-339 DISEASERSIST
Disease resistance protein

RLKDKKVFIVLDNID

FPrintScan: PR00364
IPR000767
419-433 DISEASERSIST
Disease resistance protein

LGGLPLGLRVMGSHF

FPrintScan: PR00364
IPR000767
419-433 DISEASERSIST
Disease resistance protein

LGGLPLGLRVMGSHF

superfamily: SSF46785
454-564 SSF46785

ANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLT

superfamily: SSF46785
454-564 SSF46785

ANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLT

superfamily: SSF52058
538-925 SSF52058,LRR

GLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCT

superfamily: SSF52058
538-925 SSF52058,LRR

GLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCT

Gene3D: G3DSA:3.80.10.10
630-885 G3DSA:3.80.10.10

ILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCE

Gene3D: G3DSA:3.80.10.10
630-885 G3DSA:3.80.10.10

ILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCE

HMMPfam: PF07725
IPR011713
649-667 LRR_3
Leucine-rich repeat 3

YLVELNMRFSKLHKLWEGN

HMMPfam: PF07725
IPR011713
649-667 LRR_3
Leucine-rich repeat 3

YLVELNMRFSKLHKLWEGN

FPrintScan: PR00364
IPR000767
739-755 DISEASERSIST
Disease resistance protein

GNLHKLQKLTLNGCSKL

FPrintScan: PR00364
IPR000767
739-755 DISEASERSIST
Disease resistance protein

GNLHKLQKLTLNGCSKL


List of References

A Theologis, J R Ecker, C J Palm, N A Federspiel, S Kaul, O White, J Alonso, H Altafi, R Araujo, C L Bowman, S Y Brooks, E Buehler, A Chan, Q Chao, H Chen, R F Cheuk, C W Chin, M K Chung, L Conn, A B Conway, A R Conway, T H Creasy, K Dewar, P Dunn, P Etgu, T V Feldblyum, J Feng, B Fong, C Y Fujii, J E Gill, A D Goldsmith, B Haas, N F Hansen, B Hughes, L Huizar, J L Hunter, J Jenkins, C Johnson-Hopson, S Khan, E Khaykin, C J Kim, H L Koo, I Kremenetskaia, D B Kurtz, A Kwan, B Lam, S Langin-Hooper, A Lee, J M Lee, C A Lenz, J H Li, Y Li, X Lin, S X Liu, Z A Liu, J S Luros, R Maiti, A Marziali, J Militscher, M Miranda, M Nguyen, W C Nierman, B I Osborne, G Pai, J Peterson, P K Pham, M Rizzo, T Rooney, D Rowley, H Sakano, S L Salzberg, J R Schwartz, P Shinn, A M Southwick, H Sun, L J Tallon, G Tambunga, M J Toriumi, C D Town, T Utterback, S Van Aken, M Vaysberg, V S Vysotskaia, M Walker, D Wu, G Yu, C M Fraser, J C Venter, R W Davis
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Nature: 2000, 408(6814);816-20
PubMed:11130712 WorldCat.org DOI (P p)

A Theologis, J R Ecker, C J Palm, N A Federspiel, S Kaul, O White, J Alonso, H Altafi, R Araujo, C L Bowman, S Y Brooks, E Buehler, A Chan, Q Chao, H Chen, R F Cheuk, C W Chin, M K Chung, L Conn, A B Conway, A R Conway, T H Creasy, K Dewar, P Dunn, P Etgu, T V Feldblyum, J Feng, B Fong, C Y Fujii, J E Gill, A D Goldsmith, B Haas, N F Hansen, B Hughes, L Huizar, J L Hunter, J Jenkins, C Johnson-Hopson, S Khan, E Khaykin, C J Kim, H L Koo, I Kremenetskaia, D B Kurtz, A Kwan, B Lam, S Langin-Hooper, A Lee, J M Lee, C A Lenz, J H Li, Y Li, X Lin, S X Liu, Z A Liu, J S Luros, R Maiti, A Marziali, J Militscher, M Miranda, M Nguyen, W C Nierman, B I Osborne, G Pai, J Peterson, P K Pham, M Rizzo, T Rooney, D Rowley, H Sakano, S L Salzberg, J R Schwartz, P Shinn, A M Southwick, H Sun, L J Tallon, G Tambunga, M J Toriumi, C D Town, T Utterback, S Van Aken, M Vaysberg, V S Vysotskaia, M Walker, D Wu, G Yu, C M Fraser, J C Venter, R W Davis
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Nature: 2000, 408(6814);816-20
PubMed:11130712 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox