PRGDB00061653 (TIR-NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223452602 (FJ014877)
Gene Class T
Domain Type TIR, LRR
Gene Species Glycine max

Comment?

Glycine max clone cw16 TIR-NBS-LRR type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGGCATGGTCAACTTCCTCCTCTAGCACCCCTCATCAAAAGCATGAAGTGTTCCTCAGCTTCAGAGGTGAGGACACACGCTACACCTTCACTGGGCACCTTCATGCCTCTTTAACAAGACTCCAAGTCAACACATACATTGACTACAACCTTCAGAGAGGTGAAGAGATATCATCCTCACTTCTTAGGGCCATTGAGGAGGCAAAACTCTCAGTCGTTGTTTTCTCCAAAAACTATGGAAATTCCAAGTGGTGTCTTGATGAGCTTCTGAAAATACTTGAATGTAAGAATATGAGGGGGCAGATTGTGTTGCCAATTTTCTATGACATTGATCCCTCGCACGTGCGCAACCAGACGGGAACGTATGCTGAGGCATTTGCTAAACATGAGAAACACTTGCAGGGTCAAATGGACAAGGTGCAAAAGTGGAGGGTGGCTCTCAGAGAAGCAGCTAATCTCTCTGGTTGGGATTGCTCTGTCAACAGGATGGAGTCTGAACTAATCGAGAAAATTGCAAAGGATGTATTAGAAAAACTAAATCGAGTATACGTTGGCGACCTAGATCAGCAGATTGCAAAGTTAGAGCAACTTGCACAGCTTCAGCATCAATTTTTGCAAAACATACCTTCTTTGGAAAATGTGAGAAATCATAGAGCAACTGTTCAGCGTATCACGGAACTTAAAATGGAGAGAAGTGTCCGCATGCTTCGCCTCCCTCCCGACATGCTTTCACATTTGGAGAATTCAAACAATAATAATTATTTTCCTTTGTAA


Protein sequences

Name Description Sequence
TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Glycine max].

MAWSTSSSSTPHQKHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANLSGWDCSVNRMESELIEKIAKDVLEKLNRVYVGDLDQQIAKLEQLAQLQHQFLQNIPSLENVRNHRATVQRITELKMERSVRMLRLPPDMLSHLENSNNNNYFPL

TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Glycine max].

MAWSTSSSSTPHQKHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANLSGWDCSVNRMESELIEKIAKDVLEKLNRVYVGDLDQQIAKLEQLAQLQHQFLQNIPSLENVRNHRATVQRITELKMERSVRMLRLPPDMLSHLENSNNNNYFPL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-156 TIR
Toll-Interleukin receptor

WSTSSSSTPHQKHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANLSGW

superfamily: SSF52200
IPR000157
3-156 TIR
Toll-Interleukin receptor

WSTSSSSTPHQKHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANLSGW

Gene3D: G3DSA:3.40.50.10140
12-147 G3DSA:3.40.50.10140

HQKHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVAL

Gene3D: G3DSA:3.40.50.10140
12-147 G3DSA:3.40.50.10140

HQKHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVAL

ProfileScan: PS50104
IPR000157
13-153 TIR
Toll-Interleukin receptor

QKHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANL

ProfileScan: PS50104
IPR000157
13-153 TIR
Toll-Interleukin receptor

QKHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANL

HMMSmart: SM00255
IPR000157
14-153 TIR
Toll-Interleukin receptor

KHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANL

HMMSmart: SM00255
IPR000157
14-153 TIR
Toll-Interleukin receptor

KHEVFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANL

HMMPfam: PF01582
IPR000157
17-148 TIR
Toll-Interleukin receptor

VFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALR

HMMPfam: PF01582
IPR000157
17-148 TIR
Toll-Interleukin receptor

VFLSFRGEDTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALR

HMMPanther: PTHR23155:SF344
25-236 PTHR23155:SF344

DTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANLSGWDCSVNRMESELIEKIAKDVLEKLNRVYVGDLDQQIAKLEQLAQLQHQFLQNIPSLENVRNHRATVQRITELKMERSVRML

HMMPanther: PTHR23155
25-236 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANLSGWDCSVNRMESELIEKIAKDVLEKLNRVYVGDLDQQIAKLEQLAQLQHQFLQNIPSLENVRNHRATVQRITELKMERSVRML

HMMPanther: PTHR23155
25-236 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANLSGWDCSVNRMESELIEKIAKDVLEKLNRVYVGDLDQQIAKLEQLAQLQHQFLQNIPSLENVRNHRATVQRITELKMERSVRML

HMMPanther: PTHR23155:SF344
25-236 PTHR23155:SF344

DTRYTFTGHLHASLTRLQVNTYIDYNLQRGEEISSSLLRAIEEAKLSVVVFSKNYGNSKWCLDELLKILECKNMRGQIVLPIFYDIDPSHVRNQTGTYAEAFAKHEKHLQGQMDKVQKWRVALREAANLSGWDCSVNRMESELIEKIAKDVLEKLNRVYVGDLDQQIAKLEQLAQLQHQFLQNIPSLENVRNHRATVQRITELKMERSVRML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox