PRGDB00061654 (TIR-NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223452592 (FJ014872)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Glycine max

Comment?

Glycine max clone cw11 TIR-NBS-LRR type disease resistance protein mRNA, complete cds.

DNA Sequence

ATGAGTGATGGGGAGACCTTGGTGTCAAAAGGTGGAAAGTTTGAATTTGGTTTTTTCAGTCCAGGTAATTCCCATAAACGTTATGTGGGAATTTGGTACAAGAATATCCCAATTCAGACAGTGGTTTGGGTTGCTAATAGGGCCAACCCCATCAATGATTCCTCAGGCAATCTTGTTCTCACCAAAAATGAGTCTCTAGTTTGGTACACCAACAACTCTCACAACCAAGCACAGAATCCAGTGGCGGAGCTCTTGGACAGTGGCAATCTTGTCATAAGAAATGATGGAGAAACAAACCCAGAAGCGTATTTGTGGCAAAGTTTTGACTATCCATCTGATACATTCCTGCCAGGAATGAAGTTGGGATGGAATCTCCGAATCGGTCATGAATGGAAACAAACAGCATGGAAGAGTCCAGATGATCCATCACCAGGAGATGTTTATCGCGTTTTAGAACTCTATAACTATCCTGAGTTTTATGTAATGAAAGGAACAAAAAAGGCATACCGGTTTGGACCTTGGAATGGCCTATATTTTAGTGGATTGTCTGACTTTGAGAATGGCACCATGTATAGCTTTTGTTATGTCAGCAATAAACATGAGATTTCCTTCACATATAGCATTGCAAATGATTCTTTCATCGCCAGATCTGTCGCAAATCAAACAGCAATTACAATTTATCGCTATATGTGGGTGGTAGGAGAACAAGATTGGAAGATGTCTAGATCCTTCCCACAAGAGTTTTGTGACACTTATAGCCTCTGTGGAGCTTACGGGAATTGCGTAAGCAGTACTCAACGTCAAGCCTGCCAATGTTTAAAAGGTTTCAGTCCAAAGTCACCAGAAGCATGGAACTCATCGGATTGGAGTGGAGGATGTCTCAAAGTTCCGGATACTACACATACTTGGTGGGATGAGAGTATTGGTCTAGAGGAATGCAGAGTGAAGTGTTTGAATAGTTGTTCTTGTATGGCCTATTCTAATTCAGATATAAGAGGTGAAGGTAGTGGCTGTGTCATGTGGTTTGGAGATCTAATTGATATGAAACAGCTTCAAACTGAAGCCGGAAGACCAATGCTGGTGCTGATCCTCGAAGTTCAGCAACAAACACAACATGTAACATCATGTATGGTCACGAAATCGAGTCTAAAAAATATCATATTTATCCTCACTAATGGATCTCCATTGAATGAAGAAAAGCTTGAAAATTTGGCAAAAGAAGAGTGGCAACTACACATATCAGTGGAGTATTTTCATGCATGCATACCTCTTCGATCATTATGCCTTTTGAAAAGATTCGATCAACAATTAAACTTTAAAATAATTTATAATTTCAACAAATATTTTGCAATTGAAATGGCTTCTACTTCTAATGCCATCATCCAATGCACCTCTTCTTCTTCTTCTTCTTCGTTTGAGTATGACGTGTTTGTGAGCTTCCGCGGTGAAGACACACGCAACAGCTTCACCGGTTTTCTTTTTGAAGCTCTGAAAAAACAAGGCATCGAGGCCTTCAAAGATGATAAAGATATCAGGAAAGGCGAATCCATAGCACCAGAGCTAATACGAGCCATTGAAGGGTCTCATGTTTTCCTTGTTGTCTTTTCCAAGGACTATGCTTCCTCAACTTGGTGCCTGCGTGAACTAGCACATATCTGGGATTGCATTCAAAAATCACCCAGACATCTTCTGCCTATTTTCTATGATGTTGATCCATCACAAGTGCGAAAACAGAGTGGAGACTATGAGAAAGCCTTTGCCCAACACCAACAAAGTTCCAGGTTCGAAGACAAGGAAATTAAAACATGGAGAGAAGTTCTGAACGATGTAGGCAATCTCTCTGGTTGGGATATAAAAAATAAGCAACAACATGCAGTGATTGAAGAAATTGTTCAGCAGATAAAAAATATCTTGGGTTGCAAATTTTCTACTCTTCCATATGATAATCTAGTTGGGATGGAATCTCATTTTGCTACATTATCAAAGCTAATATGTCTGGGGCTGGTTAATGATGATGTTCGAGTTGTTGGAATTACTGGGATGGGTGGAATAGGAAAGTCCACTCTTGGTCAAGCTTTATATGAAAGAATCTCTCATCAATTTAATTCTCGTTGTTATATTGATGATGTAAGTAAACTTTATCAAGGTTATGGTACATTAGGTGTACAAAAAGAGTTACTTTCTCAGTCTCTAAATGAAAAAAATCTAAAGATTTGCAATGTATCTAATGGAACACTTCTGGTATGGGAGAGGCTATCCAATGCAAAGGCACTTATAATTCTTGACAATGTTGATCAAGATAAACAGCTTGATATGTTTACAGGGGGTAGAAATGATCTGTTACGTAAATGCTTAGGTAAAGGGAGCATAGTCATTATAATTTCTAGGGATCAACAAATATTGAAGGCACATGGAGTAGATGTTATTTACCGAGTGGAGCCATTGAATGACAATGATGCTCTTGGATTGTTTTGCAAAAAAGCATTTAAAAATAATTATATGATGAGTGATTTTGAAAAGTTGACTTCTGATGTATTATCACATTGTCAAGGTCATCCCTTAGCAATTGAAGTGCTAGGCTCATCTTTATTTGATAAAGATGTCTTACATTGGAGGAGTGCATTGGCTTTGTTAAGAGAAAATAAAAGTAAAAGTATTATGAATGTGTTGCGAATAAGTTTTGATCAATTAGAGGATACACACAAGGAAATATTTCTAGATATTGCATGTTTCTTCAACCATTATCCTGTGAAATATGTGAAGGAAGTTCTAGATTTTCGTGGATTTAATCCCGAATATGGCCTACAAGTTCTCGTTGATAAATCACTCATAACCATGGATTCGAGGCAGATTCAAATGCATGACTTGTTGTGCGATTTGGGCAAGTATATTGTTAGAGAAAAATCACCTAGGAAACCATGGAAGTGGAGCAGGTTGTGGGATGTTAAAGATATCCTTAAAGTTATGTCAGATAATAAGGCAGCAGACAATGTGGAGGCCATATTTCTTATAGAAAAATCTGACATTCTTCGAACAATTTCAACAATGAGGGTCGATGTTCTATCAACAATGAGTTGCCTTAAGCTTCTCAAACTTGACCATTTGGACTTTAACGTCAAAATCAATTTTTTTTCAGGAACACTTGTTAAGCTTTCCAATGAATTAGGATATCTTGGTTGGGAAAAGTATCCTTTTGAGTGTTTGCCACCAAGTTTTGAGCCCGACAAACTTGTTGAGTTGATTCTACCTAAAAGCAACATCAAACAACTTTGGGAAGGCACAAAGCCTCTACCTAATTTGAGGCGTTTGGATCTCTCTGGCTCCAAAAATCTAATTAAAATGCCATATATTGGAGATGCCCTATATCTTGAGAGTCTTGATCTCGAAGGATGTATACAACTCGAAGAGATCGGTCTGTCCATTGTTCTTTCACCAAAGCTTACTTCTCTGAATTTGAGAAATTGCAAAAGTCTTATCAAGCTGCCACAGTTTGGAGAGGACCTAATTCTTGAAAAGCTACTTCTCGGAGGATGTCAAAAACTCAGACACATTGATCCATCCATCGGTCTTCTAAAAAAGCTCAGAAGATTGAATTTGAAAAACTGCAAAAATCTAGTAAGCTTACCCAATAGCATACTAGGCCTCAATTCTCTTGAAGATCTGAATCTCTCTGGCTGTTCAAAACTGTACAACACCGAGTTATTATATGAACTAAGGGATGCAGAGCAATTGAAGAAGATTGATATAGATGGAGCTCCTATTCATTTCCAATCAACATCTTCCTACTCCAGAGAACATAAAAAATCAGTTAGTTGCTTAATGCCTTCCTCCCCAATATTTCCATGTATGCTTAAACTTGATCTAAGTTTCTGTAATTTAGTTGAAATCCCTGATGCTATTGGAATTATGTGTTGCTTACAAAGGCTAGATTTAAGTGGTAACAATTTTGCTACACTGCCCAACCTCAAGAAGCTTTCCAAACTGGTCTGTTTGAAGTTACAACATTGCAAGCAGTTGAAATCTTTGCCTGAGCTCCCTTCACGGATTTACAATTTTGATAGACTAAGACAAGCAGGATTATACATTTTTAACTGCCCAGAATTAGTTGATAGGGAACGCTGCACTGACATGGCTTTTTCGTGGACGATGCAATCGTGTCAGGTGTTATACTTATGTCCGTTCTACCATGTTAGTAGAGTTGTTAGTCCAGGAAGTGAAATACCAAGGTGGTTCAATAATGAGCATGAGGGAAATTGTGTAAGCTTAGACGCATCTCCTGTTATGCATGACCATAATTGGATTGGCGTTGCGTTTTGTGCAATATTCGTCGTACCTCATGAAACACTCTCAGCAATGAGTTTTTCAGAGACAGAAGGGAACTACCCTGATTATAATGATATTCCAGTGGATTTTTATGAAGATGTAGATCTAGAACTTGTTTTAGACAAATCAGATCACATGTGGCTATTCTTTGTTGGTCGAGGAAGGTTCATTGAATATTTCCATCTGAAGCACAAATATCTTGGCAGATTGCTTTTGAAATGTGATAATGAAGGGATAAGGTTCAAAGAATCATATGCTGAGGTGAAGAAATATGGATATCGCTGGGTATATAAAGGGGATATAGAATGGTCGGCTAGGAAGCACTGGGGAAATTGA


Protein sequences

Name Description Sequence
TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Glycine max].

MSDGETLVSKGGKFEFGFFSPGNSHKRYVGIWYKNIPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYPSDTFLPGMKLGWNLRIGHEWKQTAWKSPDDPSPGDVYRVLELYNYPEFYVMKGTKKAYRFGPWNGLYFSGLSDFENGTMYSFCYVSNKHEISFTYSIANDSFIARSVANQTAITIYRYMWVVGEQDWKMSRSFPQEFCDTYSLCGAYGNCVSSTQRQACQCLKGFSPKSPEAWNSSDWSGGCLKVPDTTHTWWDESIGLEECRVKCLNSCSCMAYSNSDIRGEGSGCVMWFGDLIDMKQLQTEAGRPMLVLILEVQQQTQHVTSCMVTKSSLKNIIFILTNGSPLNEEKLENLAKEEWQLHISVEYFHACIPLRSLCLLKRFDQQLNFKIIYNFNKYFAIEMASTSNAIIQCTSSSSSSSFEYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNLSGWDIKNKQQHAVIEEIVQQIKNILGCKFSTLPYDNLVGMESHFATLSKLICLGLVNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYVKEVLDFRGFNPEYGLQVLVDKSLITMDSRQIQMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMSDNKAADNVEAIFLIEKSDILRTISTMRVDVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPIHFQSTSSYSREHKKSVSCLMPSSPIFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPSRIYNFDRLRQAGLYIFNCPELVDRERCTDMAFSWTMQSCQVLYLCPFYHVSRVVSPGSEIPRWFNNEHEGNCVSLDASPVMHDHNWIGVAFCAIFVVPHETLSAMSFSETEGNYPDYNDIPVDFYEDVDLELVLDKSDHMWLFFVGRGRFIEYFHLKHKYLGRLLLKCDNEGIRFKESYAEVKKYGYRWVYKGDIEWSARKHWGN

TIR-NBS-LRR type disease resistance protein TIR-NBS-LRR type disease resistance protein [Glycine max].

MSDGETLVSKGGKFEFGFFSPGNSHKRYVGIWYKNIPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYPSDTFLPGMKLGWNLRIGHEWKQTAWKSPDDPSPGDVYRVLELYNYPEFYVMKGTKKAYRFGPWNGLYFSGLSDFENGTMYSFCYVSNKHEISFTYSIANDSFIARSVANQTAITIYRYMWVVGEQDWKMSRSFPQEFCDTYSLCGAYGNCVSSTQRQACQCLKGFSPKSPEAWNSSDWSGGCLKVPDTTHTWWDESIGLEECRVKCLNSCSCMAYSNSDIRGEGSGCVMWFGDLIDMKQLQTEAGRPMLVLILEVQQQTQHVTSCMVTKSSLKNIIFILTNGSPLNEEKLENLAKEEWQLHISVEYFHACIPLRSLCLLKRFDQQLNFKIIYNFNKYFAIEMASTSNAIIQCTSSSSSSSFEYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNLSGWDIKNKQQHAVIEEIVQQIKNILGCKFSTLPYDNLVGMESHFATLSKLICLGLVNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYVKEVLDFRGFNPEYGLQVLVDKSLITMDSRQIQMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMSDNKAADNVEAIFLIEKSDILRTISTMRVDVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPIHFQSTSSYSREHKKSVSCLMPSSPIFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPSRIYNFDRLRQAGLYIFNCPELVDRERCTDMAFSWTMQSCQVLYLCPFYHVSRVVSPGSEIPRWFNNEHEGNCVSLDASPVMHDHNWIGVAFCAIFVVPHETLSAMSFSETEGNYPDYNDIPVDFYEDVDLELVLDKSDHMWLFFVGRGRFIEYFHLKHKYLGRLLLKCDNEGIRFKESYAEVKKYGYRWVYKGDIEWSARKHWGN

Domains

Domain Start-End Description Sequence

ProfileScan: PS50927
IPR001480
1-105 BULB_LECTIN
Bulb-type lectin domain

MSDGETLVSKGGKFEFGFFSPGNSHKRYVGIWYKNIPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLW

ProfileScan: PS50927
IPR001480
1-105 BULB_LECTIN
Bulb-type lectin domain

MSDGETLVSKGGKFEFGFFSPGNSHKRYVGIWYKNIPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLW

HMMSmart: SM00108
IPR001480
2-111 B_lectin
Bulb-type lectin domain

SDGETLVSKGGKFEFGFFSPGNSHKRYVGIWYKNIPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYP

HMMSmart: SM00108
IPR001480
2-111 B_lectin
Bulb-type lectin domain

SDGETLVSKGGKFEFGFFSPGNSHKRYVGIWYKNIPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYP

superfamily: SSF51110
IPR001480
29-142 B_lectin
Bulb-type lectin domain

VGIWYKNIPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYPSDTFLPGMKLGWNLRIGHEWKQTAWKSPDDP

superfamily: SSF51110
IPR001480
29-142 B_lectin
Bulb-type lectin domain

VGIWYKNIPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYPSDTFLPGMKLGWNLRIGHEWKQTAWKSPDDP

Gene3D: G3DSA:2.90.10.10
IPR001480
36-113 Bulb-type_lectin_dom
Bulb-type lectin domain

IPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYPSD

Gene3D: G3DSA:2.90.10.10
IPR001480
36-113 Bulb-type_lectin_dom
Bulb-type lectin domain

IPIQTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYPSD

HMMPfam: PF01453
IPR001480
39-143 B_lectin
Bulb-type lectin domain

QTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYPSDTFLPGMKLGWNLRIGHEWKQTAWKSPDDPS

HMMPfam: PF01453
IPR001480
39-143 B_lectin
Bulb-type lectin domain

QTVVWVANRANPINDSSGNLVLTKNESLVWYTNNSHNQAQNPVAELLDSGNLVIRNDGETNPEAYLWQSFDYPSDTFLPGMKLGWNLRIGHEWKQTAWKSPDDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
145-181 Bulb-type_lectin_dom
Bulb-type lectin domain

GDVYRVLELYNYPEFYVMKGTKKAYRFGPWNGLYFSG

Gene3D: G3DSA:2.90.10.10
IPR001480
145-181 Bulb-type_lectin_dom
Bulb-type lectin domain

GDVYRVLELYNYPEFYVMKGTKKAYRFGPWNGLYFSG

HMMPfam: PF00954
IPR000858
169-280 S_locus_glycop
S-locus glycoprotein

YRFGPWNGLYFSGLSDFENGTMYSFCYVSNKHEISFTYSIANDSFIARSVANQTAITIYRYMWVVGEQDWKMSRSFPQEFCDTYSLCGAYGNCVSSTQRQACQCLKGFSPKS

HMMPfam: PF00954
IPR000858
169-280 S_locus_glycop
S-locus glycoprotein

YRFGPWNGLYFSGLSDFENGTMYSFCYVSNKHEISFTYSIANDSFIARSVANQTAITIYRYMWVVGEQDWKMSRSFPQEFCDTYSLCGAYGNCVSSTQRQACQCLKGFSPKS

ProfileScan: PS50948
IPR003609
293-364 PAN
Apple-like

CLKVPDTTHTWWDESIGLEECRVKCLNSCSCMAYSNSDIRGEGSGCVMWFGDLIDMKQLQTEAGRPMLVLIL

ProfileScan: PS50948
IPR003609
293-364 PAN
Apple-like

CLKVPDTTHTWWDESIGLEECRVKCLNSCSCMAYSNSDIRGEGSGCVMWFGDLIDMKQLQTEAGRPMLVLIL

HMMPfam: PF08276
IPR013227
294-348 PAN_2
PAN-2 domain

LKVPDTTHTWWDESIGLEECRVKCLNSCSCMAYSNSDIRGEGSGCVMWFGDLIDM

HMMPfam: PF08276
IPR013227
294-348 PAN_2
PAN-2 domain

LKVPDTTHTWWDESIGLEECRVKCLNSCSCMAYSNSDIRGEGSGCVMWFGDLIDM

superfamily: SSF52200
IPR000157
462-616 TIR
Toll-Interleukin receptor

QCTSSSSSSSFEYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNLSGW

superfamily: SSF52200
IPR000157
462-616 TIR
Toll-Interleukin receptor

QCTSSSSSSSFEYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNLSGW

Gene3D: G3DSA:3.40.50.10140
470-599 G3DSA:3.40.50.10140

SSFEYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKE

Gene3D: G3DSA:3.40.50.10140
470-599 G3DSA:3.40.50.10140

SSFEYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKE

ProfileScan: PS50104
IPR000157
472-613 TIR
Toll-Interleukin receptor

FEYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNL

ProfileScan: PS50104
IPR000157
472-613 TIR
Toll-Interleukin receptor

FEYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNL

HMMSmart: SM00255
IPR000157
473-613 TIR
Toll-Interleukin receptor

EYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNL

HMMSmart: SM00255
IPR000157
473-613 TIR
Toll-Interleukin receptor

EYDVFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNL

HMMPfam: PF01582
IPR000157
476-608 TIR
Toll-Interleukin receptor

VFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLN

HMMPfam: PF01582
IPR000157
476-608 TIR
Toll-Interleukin receptor

VFVSFRGEDTRNSFTGFLFEALKKQGIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLN

HMMPanther: PTHR11017
501-1373 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNLSGWDIKNKQQHAVIEEIVQQIKNILGCKFSTLPYDNLVGMESHFATLSKLICLGLVNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYVKEVLDFRGFNPEYGLQVLVDKSLITMDSRQIQMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMSDNKAADNVEAIFLIEKSDILRTISTMRVDVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPIHFQSTSSYSREHKKSVSCLMPSSPIFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPSRIYNFDRLRQAGLYIFNCPELVDRER

HMMPanther: PTHR11017:SF20
501-1373 PTHR11017:SF20,SUBFAMILY NOT NAMED

GIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNLSGWDIKNKQQHAVIEEIVQQIKNILGCKFSTLPYDNLVGMESHFATLSKLICLGLVNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYVKEVLDFRGFNPEYGLQVLVDKSLITMDSRQIQMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMSDNKAADNVEAIFLIEKSDILRTISTMRVDVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPIHFQSTSSYSREHKKSVSCLMPSSPIFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPSRIYNFDRLRQAGLYIFNCPELVDRER

HMMPanther: PTHR11017:SF20
501-1373 PTHR11017:SF20,SUBFAMILY NOT NAMED

GIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNLSGWDIKNKQQHAVIEEIVQQIKNILGCKFSTLPYDNLVGMESHFATLSKLICLGLVNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYVKEVLDFRGFNPEYGLQVLVDKSLITMDSRQIQMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMSDNKAADNVEAIFLIEKSDILRTISTMRVDVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPIHFQSTSSYSREHKKSVSCLMPSSPIFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPSRIYNFDRLRQAGLYIFNCPELVDRER

HMMPanther: PTHR11017
501-1373 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GIEAFKDDKDIRKGESIAPELIRAIEGSHVFLVVFSKDYASSTWCLRELAHIWDCIQKSPRHLLPIFYDVDPSQVRKQSGDYEKAFAQHQQSSRFEDKEIKTWREVLNDVGNLSGWDIKNKQQHAVIEEIVQQIKNILGCKFSTLPYDNLVGMESHFATLSKLICLGLVNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYVKEVLDFRGFNPEYGLQVLVDKSLITMDSRQIQMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMSDNKAADNVEAIFLIEKSDILRTISTMRVDVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPIHFQSTSSYSREHKKSVSCLMPSSPIFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPSRIYNFDRLRQAGLYIFNCPELVDRER

superfamily: SSF52540
632-886 SSF52540

QQIKNILGCKFSTLPYDNLVGMESHFATLSKLICLGLVNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSI

superfamily: SSF52540
632-886 SSF52540

QQIKNILGCKFSTLPYDNLVGMESHFATLSKLICLGLVNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSI

HMMPfam: PF00931
IPR002182
669-920 NB-ARC,NBS
NB-ARC

VNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYV

HMMPfam: PF00931
IPR002182
669-920 NB-ARC,NBS
NB-ARC

VNDDVRVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQSLNEKNLKICNVSNGTLLVWERLSNAKALIILDNVDQDKQLDMFTGGRNDLLRKCLGKGSIVIIISRDQQILKAHGVDVIYRVEPLNDNDALGLFCKKAFKNNYMMSDFEKLTSDVLSHCQGHPLAIEVLGSSLFDKDVLHWRSALALLRENKSKSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYV

Gene3D: G3DSA:3.40.50.300
674-730 G3DSA:3.40.50.300

RVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQS

Gene3D: G3DSA:3.40.50.300
674-730 G3DSA:3.40.50.300

RVVGITGMGGIGKSTLGQALYERISHQFNSRCYIDDVSKLYQGYGTLGVQKELLSQS

FPrintScan: PR00364
IPR000767
675-690 DISEASERSIST
Disease resistance protein

VVGITGMGGIGKSTLG

FPrintScan: PR00364
IPR000767
675-690 DISEASERSIST
Disease resistance protein

VVGITGMGGIGKSTLG

FPrintScan: PR00364
IPR000767
751-765 DISEASERSIST
Disease resistance protein

RLSNAKALIILDNVD

FPrintScan: PR00364
IPR000767
751-765 DISEASERSIST
Disease resistance protein

RLSNAKALIILDNVD

FPrintScan: PR00364
IPR000767
849-863 DISEASERSIST
Disease resistance protein

CQGHPLAIEVLGSSL

FPrintScan: PR00364
IPR000767
849-863 DISEASERSIST
Disease resistance protein

CQGHPLAIEVLGSSL

superfamily: SSF46785
884-990 SSF46785

KSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYVKEVLDFRGFNPEYGLQVLVDKSLITMDSRQIQMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMS

superfamily: SSF46785
884-990 SSF46785

KSIMNVLRISFDQLEDTHKEIFLDIACFFNHYPVKYVKEVLDFRGFNPEYGLQVLVDKSLITMDSRQIQMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMS

superfamily: SSF52058
952-1419 SSF52058,LRR

QMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMSDNKAADNVEAIFLIEKSDILRTISTMRVDVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPIHFQSTSSYSREHKKSVSCLMPSSPIFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPSRIYNFDRLRQAGLYIFNCPELVDRERCTDMAFSWTMQSCQVLYLCPFYHVSRVVSPGSEIPRWFNNEHEGNC

superfamily: SSF52058
952-1419 SSF52058,LRR

QMHDLLCDLGKYIVREKSPRKPWKWSRLWDVKDILKVMSDNKAADNVEAIFLIEKSDILRTISTMRVDVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPIHFQSTSSYSREHKKSVSCLMPSSPIFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPSRIYNFDRLRQAGLYIFNCPELVDRERCTDMAFSWTMQSCQVLYLCPFYHVSRVVSPGSEIPRWFNNEHEGNC

Gene3D: G3DSA:3.80.10.10
1019-1254 G3DSA:3.80.10.10

DVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPI

Gene3D: G3DSA:3.80.10.10
1019-1254 G3DSA:3.80.10.10

DVLSTMSCLKLLKLDHLDFNVKINFFSGTLVKLSNELGYLGWEKYPFECLPPSFEPDKLVELILPKSNIKQLWEGTKPLPNLRRLDLSGSKNLIKMPYIGDALYLESLDLEGCIQLEEIGLSIVLSPKLTSLNLRNCKSLIKLPQFGEDLILEKLLLGGCQKLRHIDPSIGLLKKLRRLNLKNCKNLVSLPNSILGLNSLEDLNLSGCSKLYNTELLYELRDAEQLKKIDIDGAPI

HMMPfam: PF07725
IPR011713
1076-1095 LRR_3
Leucine-rich repeat 3

KLVELILPKSNIKQLWEGTK

HMMPfam: PF07725
IPR011713
1076-1095 LRR_3
Leucine-rich repeat 3

KLVELILPKSNIKQLWEGTK

FPrintScan: PR00364
IPR000767
1095-1111 DISEASERSIST
Disease resistance protein

KPLPNLRRLDLSGSKNL

FPrintScan: PR00364
IPR000767
1095-1111 DISEASERSIST
Disease resistance protein

KPLPNLRRLDLSGSKNL

ProfileScan: PS51450
1122-1144 LRR,Leucine-rich repeat profile.

YLESLDLEGCIQLEEIGLSIVLS

ProfileScan: PS51450
1122-1144 LRR,Leucine-rich repeat profile.

YLESLDLEGCIQLEEIGLSIVLS

ProfileScan: PS51450
1193-1215 LRR,Leucine-rich repeat profile.

KLRRLNLKNCKNLVSLPNSILGL

HMMPfam: PF00560
IPR001611
1193-1213 LRR_1
Leucine-rich repeat

KLRRLNLKNCKNLVSLPNSIL

ProfileScan: PS51450
1193-1215 LRR,Leucine-rich repeat profile.

KLRRLNLKNCKNLVSLPNSILGL

HMMPfam: PF00560
IPR001611
1193-1213 LRR_1
Leucine-rich repeat

KLRRLNLKNCKNLVSLPNSIL

ProfileScan: PS51450
1217-1239 LRR,Leucine-rich repeat profile.

SLEDLNLSGCSKLYNTELLYELR

ProfileScan: PS51450
1217-1239 LRR,Leucine-rich repeat profile.

SLEDLNLSGCSKLYNTELLYELR

Gene3D: G3DSA:3.80.10.10
1279-1347 G3DSA:3.80.10.10

IFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPS

Gene3D: G3DSA:3.80.10.10
1279-1347 G3DSA:3.80.10.10

IFPCMLKLDLSFCNLVEIPDAIGIMCCLQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELPS

ProfileScan: PS51450
1305-1326 LRR,Leucine-rich repeat profile.

CLQRLDLSGNNFATLPNLKKLS

ProfileScan: PS51450
1305-1326 LRR,Leucine-rich repeat profile.

CLQRLDLSGNNFATLPNLKKLS

HMMPfam: PF12799
1306-1346 LRR_4,Leucine Rich repeats (2 copies)

LQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELP

HMMPfam: PF12799
1306-1346 LRR_4,Leucine Rich repeats (2 copies)

LQRLDLSGNNFATLPNLKKLSKLVCLKLQHCKQLKSLPELP

ProfileScan: PS51450
1327-1349 LRR,Leucine-rich repeat profile.

KLVCLKLQHCKQLKSLPELPSRI

ProfileScan: PS51450
1327-1349 LRR,Leucine-rich repeat profile.

KLVCLKLQHCKQLKSLPELPSRI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox