PRGDB00061666 (NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 212717158 (EU888332)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

Glycine max clone 8070623 NBS-LRR disease resistance protein mRNA, complete cds.

DNA Sequence

ATGCAACTTGGGAAATGGGTTGTAGACCTTGTTCTCATATTTTCACTTCTCAGTCAATTCTCAGAAACTGTGGCAGAGACATCATCCTATTCAACACCACAGCCACAGCCTCCAATCTGTTCAGAAGAAGACAGAGCTTCTCTTCTCAGCTTCAAAGCAAGCATTTCACAGGACACAACAGAGACACTGTCCACGTGGACTGGCAGAGATTGCTGCGATGGTGGGTGGGAAGGAGTTGAGTGCAATCCATCCACAGGGCGTGTAAACGTGTTGCAGATTCAGAGGCCAGGGAGAGATGCTGATGCAACTTACATGAAGGGTACTCTTTCTCCTTCTCTGGGCAACTTACATTTCTTGGAGAGCCTTTCATTGAGTGGGAACCATCTGAAAGGACAGATCCCACCAACACTTGGGGGTTTGAGGAACCTTGCCCAACTTAATTTAGCAAGGAATTCTCTGACAGGTCCTATCCCTCTTAGTTTCAAAACCCTTATTAATTTGCAATACCTTGATCTCAGCCACAATTTGTTATCATCTCCCATCCCGGATTTTGTTGGGGACTTCAAAAATTTGACGTATTTAGACCTATCCTCTAACCTTCTAACCGGAAAAATTCCAGTTTCCTTGTTCAGCCTCGTCAATCTTTTAGACTTGTCATTGAGCTATAACAAGTTCGCAGGGAACATTCCAGATCAGGTTGGAAATCTGAAATCCCTGACAAGTCTTCAACTCAGTGGCAATCTGCTCACAGGGCATATTCCACTGTCCATATCAAGATTACAGAACCTTTGGTACCTCAATATATCGAGAAATTGTCTTTCAGATCCCTTACCAGCAATCCCTACCAAGGGCATCCCTTCCCTTTTGTCCATAGACCTGTCTTATAATAATCTCAGCCTTGGAATTTTACCTGATTGGATCAGAAGCAAGCAGCTTAAAGATGTCCATCTAGCTGGGTGCAAATTGAAGGGAGATCTTCCACACTTCACAAGACCTGACTCTCTCAGCTCTATTGACCTATCAGATAACTATCTGGTGGATGGTATTTCAAATTTCTTCACAAACATGTCCAGCTTGCAAAAGGTCAAGCTCTCAAACAACCAGCTGAGGTTTGACATTTCTGAAATCAAATTACCAACAGAACTGTCTTCCATAGATTTGCATGCTAATCTGCTGGTGGGTTCACTATCAACAATCATAAATGACAGGACAAGCAGCTCTTTGGAGGTTATAGACGTGTCAAACAATTTTATTTCAGGTCACATTCCAGAATTTGTGGAAGGCTCAAGCTTGAAGGTGTTAAACTTGGGGAGCAACAACATATCAGGTTCAATCCCAATTTCTATCTCGAACTTGATAAATCTTGAGAGACTGGACATTTCAAGAAATCACATATTGGGAACCATCCCTTCAAGTCTAGGTCAGTTGTTGAAACTACTATGGCTTGATGTATCCATAAACGGATTAACAGGGCAAATACCAAGTAGCTTGTCACAGATAACTGGTCTTAAGCATGCAAACTTCAGGGCAAACAGGCTGTGTGGTGAAATACCACAAAGTAGACCATTCAACATTTTTCGACCAGTTGCTTACATCCACAACTTGTGCTTATGTGGCAAACCTTTACAACCATGCAAGAAACAATGGAGTATGGGTCAGTGA


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Glycine max].

MQLGKWVVDLVLIFSLLSQFSETVAETSSYSTPQPQPPICSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRPDSLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQSRPFNIFRPVAYIHNLCLCGKPLQPCKKQWSMGQ

NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Glycine max].

MQLGKWVVDLVLIFSLLSQFSETVAETSSYSTPQPQPPICSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRPDSLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQSRPFNIFRPVAYIHNLCLCGKPLQPCKKQWSMGQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
38-332 SSF52058,LRR

PICSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRP

superfamily: SSF52058
38-332 SSF52058,LRR

PICSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRP

Gene3D: G3DSA:3.80.10.10
40-341 G3DSA:3.80.10.10

CSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRPDSLSSIDLS

Gene3D: G3DSA:3.80.10.10
40-341 G3DSA:3.80.10.10

CSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRPDSLSSIDLS

HMMPanther: PTHR24420
40-544 PTHR24420,FAMILY NOT NAMED

CSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRPDSLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQSRPFNIFRPVAYIHNLCLCGKPLQP

HMMPanther: PTHR24420:SF506
40-544 PTHR24420:SF506

CSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRPDSLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQSRPFNIFRPVAYIHNLCLCGKPLQP

HMMPanther: PTHR24420:SF506
40-544 PTHR24420:SF506

CSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRPDSLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQSRPFNIFRPVAYIHNLCLCGKPLQP

HMMPanther: PTHR24420
40-544 PTHR24420,FAMILY NOT NAMED

CSEEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECNPSTGRVNVLQIQRPGRDADATYMKGTLSPSLGNLHFLESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLLSSPIPDFVGDFKNLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLLTGHIPLSISRLQNLWYLNISRNCLSDPLPAIPTKGIPSLLSIDLSYNNLSLGILPDWIRSKQLKDVHLAGCKLKGDLPHFTRPDSLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQSRPFNIFRPVAYIHNLCLCGKPLQP

HMMPfam: PF08263
IPR013210
42-82 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

EEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECN

HMMPfam: PF08263
IPR013210
42-82 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

EEDRASLLSFKASISQDTTETLSTWTGRDCCDGGWEGVECN

ProfileScan: PS51450
118-141 LRR,Leucine-rich repeat profile.

FLESLSLSGNHLKGQIPPTLGGLR

ProfileScan: PS51450
118-141 LRR,Leucine-rich repeat profile.

FLESLSLSGNHLKGQIPPTLGGLR

HMMPfam: PF13855
119-177 LRR_8,Leucine rich repeat

LESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLL

HMMPfam: PF13855
119-177 LRR_8,Leucine rich repeat

LESLSLSGNHLKGQIPPTLGGLRNLAQLNLARNSLTGPIPLSFKTLINLQYLDLSHNLL

ProfileScan: PS51450
142-163 LRR,Leucine-rich repeat profile.

NLAQLNLARNSLTGPIPLSFKT

ProfileScan: PS51450
142-163 LRR,Leucine-rich repeat profile.

NLAQLNLARNSLTGPIPLSFKT

ProfileScan: PS51450
166-188 LRR,Leucine-rich repeat profile.

NLQYLDLSHNLLSSPIPDFVGDF

ProfileScan: PS51450
166-188 LRR,Leucine-rich repeat profile.

NLQYLDLSHNLLSSPIPDFVGDF

ProfileScan: PS51450
190-212 LRR,Leucine-rich repeat profile.

NLTYLDLSSNLLTGKIPVSLFSL

ProfileScan: PS51450
190-212 LRR,Leucine-rich repeat profile.

NLTYLDLSSNLLTGKIPVSLFSL

HMMPfam: PF13855
190-249 LRR_8,Leucine rich repeat

NLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLL

HMMPfam: PF13855
190-249 LRR_8,Leucine rich repeat

NLTYLDLSSNLLTGKIPVSLFSLVNLLDLSLSYNKFAGNIPDQVGNLKSLTSLQLSGNLL

ProfileScan: PS51450
214-236 LRR,Leucine-rich repeat profile.

NLLDLSLSYNKFAGNIPDQVGNL

ProfileScan: PS51450
214-236 LRR,Leucine-rich repeat profile.

NLLDLSLSYNKFAGNIPDQVGNL

ProfileScan: PS51450
238-261 LRR,Leucine-rich repeat profile.

SLTSLQLSGNLLTGHIPLSISRLQ

ProfileScan: PS51450
238-261 LRR,Leucine-rich repeat profile.

SLTSLQLSGNLLTGHIPLSISRLQ

ProfileScan: PS51450
262-284 LRR,Leucine-rich repeat profile.

NLWYLNISRNCLSDPLPAIPTKG

ProfileScan: PS51450
262-284 LRR,Leucine-rich repeat profile.

NLWYLNISRNCLSDPLPAIPTKG

ProfileScan: PS51450
287-307 LRR,Leucine-rich repeat profile.

SLLSIDLSYNNLSLGILPDWI

ProfileScan: PS51450
287-307 LRR,Leucine-rich repeat profile.

SLLSIDLSYNNLSLGILPDWI

HMMPfam: PF13855
311-369 LRR_8,Leucine rich repeat

QLKDVHLAGCKLKGDLPHFTRPDSLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQL

HMMPfam: PF13855
311-369 LRR_8,Leucine rich repeat

QLKDVHLAGCKLKGDLPHFTRPDSLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQL

ProfileScan: PS51450
334-356 LRR,Leucine-rich repeat profile.

SLSSIDLSDNYLVDGISNFFTNM

superfamily: SSF52058
334-546 SSF52058,LRR

SLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQSRPFNIFRPVAYIHNLCLCGKPLQPCK

ProfileScan: PS51450
334-356 LRR,Leucine-rich repeat profile.

SLSSIDLSDNYLVDGISNFFTNM

superfamily: SSF52058
334-546 SSF52058,LRR

SLSSIDLSDNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQSRPFNIFRPVAYIHNLCLCGKPLQPCK

Gene3D: G3DSA:3.80.10.10
342-520 G3DSA:3.80.10.10

DNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQS

Gene3D: G3DSA:3.80.10.10
342-520 G3DSA:3.80.10.10

DNYLVDGISNFFTNMSSLQKVKLSNNQLRFDISEIKLPTELSSIDLHANLLVGSLSTIINDRTSSSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHILGTIPSSLGQLLKLLWLDVSINGLTGQIPSSLSQITGLKHANFRANRLCGEIPQS

ProfileScan: PS51450
358-380 LRR,Leucine-rich repeat profile.

SLQKVKLSNNQLRFDISEIKLPT

ProfileScan: PS51450
358-380 LRR,Leucine-rich repeat profile.

SLQKVKLSNNQLRFDISEIKLPT

HMMPfam: PF13855
406-465 LRR_8,Leucine rich repeat

SSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHI

HMMPfam: PF13855
406-465 LRR_8,Leucine rich repeat

SSLEVIDVSNNFISGHIPEFVEGSSLKVLNLGSNNISGSIPISISNLINLERLDISRNHI

ProfileScan: PS51450
407-429 LRR,Leucine-rich repeat profile.

SLEVIDVSNNFISGHIPEFVEGS

ProfileScan: PS51450
407-429 LRR,Leucine-rich repeat profile.

SLEVIDVSNNFISGHIPEFVEGS

ProfileScan: PS51450
430-453 LRR,Leucine-rich repeat profile.

SLKVLNLGSNNISGSIPISISNLI

ProfileScan: PS51450
430-453 LRR,Leucine-rich repeat profile.

SLKVLNLGSNNISGSIPISISNLI

ProfileScan: PS51450
454-476 LRR,Leucine-rich repeat profile.

NLERLDISRNHILGTIPSSLGQL

ProfileScan: PS51450
454-476 LRR,Leucine-rich repeat profile.

NLERLDISRNHILGTIPSSLGQL

ProfileScan: PS51450
478-500 LRR,Leucine-rich repeat profile.

KLLWLDVSINGLTGQIPSSLSQI

ProfileScan: PS51450
478-500 LRR,Leucine-rich repeat profile.

KLLWLDVSINGLTGQIPSSLSQI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox