PRGDB00061671 (Putative disease resistance protein Hcr2-0B)

From PRG Wiki
Jump to: navigation, search
Putative disease resistance protein Hcr2-0B
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 16751879 (AC079179)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Oryza sativa

Comment?

Oryza sativa chromosome 10 clone OSJNBa0079B05, complete sequence.

DNA Sequence

ATGGCACTTCTTCGCTGGAAGTCCACTCTCAGGATCTCATCAGTGCATATGAGCTCCTGGAAGAACACCACAAGCCTCTGCAACTGGACAGGGATCATGTGTAGTCGTAGTGTCATCCGCCATGGACGACGACACCGTCTGCCATGGCCAGTGGTGACCAACATCTCCCTTCCAGCTTCTGGCATCCATGGCCAGCTTCGTGAGCTTGACTTCTCATCTCTACCATATCTCACATATATTGATCTCAGCAAAAACAGTCTCTCTGGTCCAATACCCTCAAATATCAACTCTCTGTCAGCTCTTGTGCACCTTGAACTTCAATTGAACCTGCTCACAGGAAGAATACCAGATGAGATTGGTGAACTACGAAGTCTCACCACACTATCCCTTTCCTTTAACAACCTCACCGGACACATCCCTGCTTCCTTGGGGAATCTAACGATGGTAACCACATTTTTCGTACACCAAAATATGATCTCCAGTTTCATCCCAAAGGAAATAGGACTGCTAGCTAACCTGCAGAGTTTAAGTCTAAGCAACAACACATTGACCGGAGAGATACCCAGAACTCTAGCAAATCTAACCAACCTAGCTACTTTGCAACTATATGGTAATGAACTGTCAGGGCCTATACCCCAAAAACTTTGCATGCTCACGAAGATCCAATATCTTGAACTTAGCGGTAATAAACTTACTGGTGAACTTCCTTCATGTTTATCCAATCTAACAAAGATGAAAGAACTTTACCTACACCAAAACCAAATCACGGGTTCCATCCCAAAAGAGATAGGAATGCTTGCTAACCTGCAACTTTTAAGTTTAGGCAATAATACCTTTAGCGGCGAGATACCCACAACTCTAGCAAATCTGACCAACCTAGCTACTTTGTACCTATGGGGTAATGAACTTTCGGGGCCTATACCCCAAAAACTCTGCATGCTCACCAAGATGCAATACCTTGGTCTTAACAGTAACAAACTTACTAGCGAAATCCCTGCATGTTTATCCGATCTAACGAAAATGGAAAAACTTTACCTATACCAAAACCAAATCACAGGTTCCATCCCAAAAGAGATAGGAATGCTTGCTAACCTGCATCTTTTAAATGTAGGCAACAATGCCTTTAGCGGCGAGATACCCATAACTCTATCAAATCTGACCAACCTAGCTACTTTGTACCTATGA


Protein sequences

Name Description Sequence
Putative disease resistance protein Hcr2-0B Putative disease resistance protein Hcr2-0B [Oryza sativa].

MALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCSRSVIRHGRRHRLPWPVVTNISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL

Putative disease resistance protein Hcr2-0B Putative disease resistance protein Hcr2-0B [Oryza sativa].

MALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCSRSVIRHGRRHRLPWPVVTNISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF472
1-394 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCSRSVIRHGRRHRLPWPVVTNISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL

HMMPanther: PTHR24420
1-394 FAMILY NOT NAMED,FAMILY NOT NAMED

MALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCSRSVIRHGRRHRLPWPVVTNISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL

HMMPanther: PTHR24420
1-394 FAMILY NOT NAMED,FAMILY NOT NAMED

MALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCSRSVIRHGRRHRLPWPVVTNISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL

HMMPanther: PTHR24420:SF472
1-394 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCSRSVIRHGRRHRLPWPVVTNISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL

Gene3D: G3DSA:3.80.10.10
2-225 no description

ALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCSRSVIRHGRRHRLPWPVVTNISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLE

HMMPfam: PF08263
IPR013210
2-35 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCS

Gene3D: G3DSA:3.80.10.10
2-225 no description

ALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCSRSVIRHGRRHRLPWPVVTNISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLE

HMMPfam: PF08263
IPR013210
2-35 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ALLRWKSTLRISSVHMSSWKNTTSLCNWTGIMCS

superfamily: SSF52047
54-394 RNI-like,LRR

NISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL

superfamily: SSF52047
54-394 RNI-like,LRR

NISLPASGIHGQLRELDFSSLPYLTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL

HMMSmart: SM00365
74-97 Leucine-rich repeat, SDS22-like subfamily

LPYLTYIDLSKNSLSGPIPSNINS

HMMSmart: SM00365
74-97 Leucine-rich repeat, SDS22-like subfamily

LPYLTYIDLSKNSLSGPIPSNINS

FPrintScan: PR00019
77-90 LEURICHRPT,Leucine-rich repeat signature

LTYIDLSKNSLSGP

HMMPfam: PF00560
IPR001611
77-98 LRR_1
Leucine-rich repeat

LTYIDLSKNSLSGPIPSNINSL

FPrintScan: PR00019
77-90 LEURICHRPT,Leucine-rich repeat signature

LTYIDLSKNSLSGP

HMMPfam: PF00560
IPR001611
77-98 LRR_1
Leucine-rich repeat

LTYIDLSKNSLSGPIPSNINSL

Seg: seg
122-136 seg

LRSLTTLSLSFNNLT

Seg: seg
122-136 seg

LRSLTTLSLSFNNLT

HMMSmart: SM00369
IPR003591
122-146 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLTTLSLSFNNLTGHIPASLGNL

HMMSmart: SM00369
IPR003591
122-146 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLTTLSLSFNNLTGHIPASLGNL

HMMPfam: PF00560
IPR001611
124-146 LRR_1
Leucine-rich repeat

SLTTLSLSFNNLTGHIPASLGNL

HMMPfam: PF00560
IPR001611
124-146 LRR_1
Leucine-rich repeat

SLTTLSLSFNNLTGHIPASLGNL

HMMSmart: SM00365
146-167 Leucine-rich repeat, SDS22-like subfamily

LTMVTTFFVHQNMISSFIPKEI

HMMSmart: SM00365
146-167 Leucine-rich repeat, SDS22-like subfamily

LTMVTTFFVHQNMISSFIPKEI

Seg: seg
169-183 seg

LLANLQSLSLSNNTL

Seg: seg
169-183 seg

LLANLQSLSLSNNTL

FPrintScan: PR00019
170-183 LEURICHRPT,Leucine-rich repeat signature

LANLQSLSLSNNTL

FPrintScan: PR00019
170-183 LEURICHRPT,Leucine-rich repeat signature

LANLQSLSLSNNTL

HMMSmart: SM00369
IPR003591
170-194 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LANLQSLSLSNNTLTGEIPRTLANL

HMMSmart: SM00365
170-196 Leucine-rich repeat, SDS22-like subfamily

LANLQSLSLSNNTLTGEIPRTLANLTN

HMMSmart: SM00369
IPR003591
170-194 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LANLQSLSLSNNTLTGEIPRTLANL

HMMSmart: SM00365
170-196 Leucine-rich repeat, SDS22-like subfamily

LANLQSLSLSNNTLTGEIPRTLANLTN

HMMPfam: PF12799
172-208 LRR_4,Leucine Rich repeats (2 copies)

NLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELS

HMMPfam: PF12799
172-208 LRR_4,Leucine Rich repeats (2 copies)

NLQSLSLSNNTLTGEIPRTLANLTNLATLQLYGNELS

Seg: seg
190-200 seg

TLANLTNLATL

Seg: seg
190-200 seg

TLANLTNLATL

HMMSmart: SM00365
218-244 Leucine-rich repeat, SDS22-like subfamily

LTKIQYLELSGNKLTGELPSCLSNLTK

HMMSmart: SM00369
IPR003591
218-241 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTKIQYLELSGNKLTGELPSCLSN

HMMSmart: SM00369
IPR003591
218-241 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTKIQYLELSGNKLTGELPSCLSN

HMMSmart: SM00365
218-244 Leucine-rich repeat, SDS22-like subfamily

LTKIQYLELSGNKLTGELPSCLSNLTK

HMMPfam: PF12799
219-256 LRR_4,Leucine Rich repeats (2 copies)

TKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQIT

HMMPfam: PF12799
219-256 LRR_4,Leucine Rich repeats (2 copies)

TKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQIT

Gene3D: G3DSA:3.80.10.10
226-394 no description

LSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL

Gene3D: G3DSA:3.80.10.10
226-394 no description

LSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIPKEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL

HMMSmart: SM00369
IPR003591
242-266 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTKMKELYLHQNQITGSIPKEIGML

HMMSmart: SM00369
IPR003591
242-266 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTKMKELYLHQNQITGSIPKEIGML

HMMSmart: SM00365
266-292 Leucine-rich repeat, SDS22-like subfamily

LANLQLLSLGNNTFSGEIPTTLANLTN

HMMSmart: SM00365
266-292 Leucine-rich repeat, SDS22-like subfamily

LANLQLLSLGNNTFSGEIPTTLANLTN

HMMPfam: PF12799
268-304 LRR_4,Leucine Rich repeats (2 copies)

NLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELS

HMMPfam: PF12799
268-304 LRR_4,Leucine Rich repeats (2 copies)

NLQLLSLGNNTFSGEIPTTLANLTNLATLYLWGNELS

Seg: seg
285-296 seg

TTLANLTNLATL

Seg: seg
285-296 seg

TTLANLTNLATL

HMMSmart: SM00369
IPR003591
314-338 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTKMQYLGLNSNKLTSEIPACLSDL

HMMSmart: SM00369
IPR003591
314-338 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTKMQYLGLNSNKLTSEIPACLSDL

HMMSmart: SM00365
338-359 Leucine-rich repeat, SDS22-like subfamily

LTKMEKLYLYQNQITGSIPKEI

HMMSmart: SM00365
338-359 Leucine-rich repeat, SDS22-like subfamily

LTKMEKLYLYQNQITGSIPKEI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox