PRGDB00061692 (disease resistance protein RPP13 variant)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP13 variant
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 224566945 (FJ624094)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana isolate UKID48 (Laz-0) disease resistance protein RPP13 variant (RPP13) gene, complete cds.

DNA Sequence

ATGGTAGATGCGATCACGGAGTTCGTTGTGGGAAAGATCGGCAACTATCTCATTGAAGAAGCATCAATGTTTATGGCAGTCAAAGAGGATCTAGAAGAGCTGAAGACGGAGTTGACGTGCATCCATGGTTATCTCAAGGACGTTGAAGCGCGAGAAAGAGAAGATGAGGTCTCAAAAGAGTGGTCAAAACTGGTTTTAGATTTCGCTTATGACGTCGAAGATGTTTTGGACACTTATCACTTGAAACTCGAAGAAAGGTCACAAAGGCGAGGCTTGAGGAGATTGACCAACAAAATAGGCAGGAAGATGGATGCGTACAGCGTAGTTGATGATATTAAAATCCTCAAGAGAAGAATCTTGGATATCACTCGCAAGAGGGAGACTTATGGTATAGGAGGCTTGAAAGAGCCTCAAGGAGGAGGGAATACTTCAAGTTTGAGAGTGAGACAACTTCGGCGTGCTCGATCTGTTGATCAAGAAGAGGTTGTAGTTGGTTTGGAAGATGATGCTAAGATTCTTTTGGAAAAGCTTCTTGATTATGAAGAGAAAAATAGATTTATTATCTCGATCTTCGGTATGGGAGGCCTTGGAAAGACTGCACTTGCTAGGAAGCTCTACAACTCAAGGGATGTGAAGGAAAGATTCGAATACCGCGCATGGACTTATGTTTCTCAAGAGTATAAAACTGGAGATATACTAATGAGAATCATTAGATCTTTGGGAATGACTTCTGGGGAAGAGTTGGAAAAGATAAGAAAGTTTGCAGACGAAGAATTAGAAGTTTACCTTCACGGTCTTCTAGAAGGGAAAAAATATTTGGTGGTGGTGGATGATATATGGGAGCGAGAAGCGTGGGAGAGCTTAAAGAGAGCGTTACCTTGCAACCATGAAGGAAGTAGAGTCATCATCACTACACGTATTAAAGCTGTGGCTGAAGGCGTAGATGGGAGATTCTATGCTCATAAGTTAAGGTTCTTGACGTTTGAAGAAAGCTGGGAGTTGTTTGAACAAAGAGCATTCAGGAATATACAAAGGAAGGATGAAGATTTGCTGAAAACCGGAAAAGAAATGGTTCAAAAATGCAGAGGGTTACCACTTTGTATAGTTGTTCTTGCGGGGCTTTTGTCGAGGAAGACACCAAGCGAGTGGAATGATGTTTGTAACAGTTTATGGAGACGCCTAAAGGATGACTCCATTCATGTTGCCCCTATTGTGTTTGATCTAAGTTTCAAGGAGCTGCGGCATGAGTCCAAACTCTGTTTTCTGTACCTTAGTATCTTCCCAGAGGACTATGAGATTGACCTAGAGAAGTTGATACGCTTACTTGTAGCAGAAGGTTTTATACAAGGGGATGAAGAGATGATGATGGAAGATGTGGCTCGGTACTACATCGAAGAGTTGATAGACAGAAGCTTACTTGAAGCAGTGAGAAGAGAAAGAGGAAAAGTGATGTCTTGTAGAATCCATGATCTTCTGAGAGACGTGGCTATCAAGAAATCTAAAGAGCTCAACTTTGTAAACGTGTATAACGATCATGTGGCCCAACATTCTTCTACTACTTGCAGAAGGGAAGTGGTTCACCATCAGTTCAAGAGATACCCATCTGAGAAATGCAAGAACAAACGGATGCGATCCTTCTTAAACTTTGGAGAATTAGAGTTTTTGGTAGGGTTTGATGTTGAAACATTGAAGCTACTTCGAGTGCTTGATCTCGGAAGGCTTCGGTTTCCTTTGAAAATTAATGGGGATCTGATCCACTTGAGGTACCTTGGAATTGGTGGTCATTCTCTCCGCTATATAGCAGCTATTACATTCAAGTTACGGTTTCTACAAACATTAGATGCATCTGACATTCATTTCATCAGGGAAACAATCGATCTCCGTAAGCTCACATCATTAAGACATGTCATAGGAAAATTCGTTGGAGAGTTGCTTATAGGCGACGCAGCGAACCTTCAGACCTTGAGGTCTATCTCCTTTGACAGCTGGAACAAACTTAAACCTGAGTTGCTCATAAATCTTCGGGACTTGTTTATCTATGAAGATTATACGCCAAAGGAGAGAAGAGTTCCTATGAGCTGGGCTTCCTTGACTAAACTAAGAAGTCTTCGTGTTCTGAAGCTGCAGGCGTATGGCATCTATTTATTGTTTGAATCGGAAGAAGCAGTTAGGTCCATGGATGTGATATCACCCAGTCTTGAATCCGTGACACTGTTTGGAATAACTTTCAAGGAAGACCCAATGCCTTTTTTCCAGAAAATGCCGAGACTGGAAGATTTGATCTTGGAAAATTGTCATTACTCGGGAGGGAAGATGAGCGTCAGCGAACAAGGTTTTGGTAGGCTGAGGAAGCTTCATTTGGCCATGGCAAGTTTAGATGAGTTGCAGATAGGAGGAGAGGCCATGCCCCATTTGATCGAGCTGCTAATAATTTCCAAAGAAGTAGACAAAGAGCTGATAATTCCAAACCGATTGCGAGCGTGTATGAAGTTAACTGCTGATGAGTTATGA


Protein sequences

Name Description Sequence
disease resistance protein RPP13 variant disease resistance protein RPP13 variant [Arabidopsis thaliana].

MVDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELTCIHGYLKDVEAREREDEVSKEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDDIKILKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIRLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYPSEKCKNKRMRSFLNFGELEFLVGFDVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPHLIELLIISKEVDKELIIPNRLRACMKLTADEL

disease resistance protein RPP13 variant disease resistance protein RPP13 variant [Arabidopsis thaliana].

MVDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELTCIHGYLKDVEAREREDEVSKEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDDIKILKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIRLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYPSEKCKNKRMRSFLNFGELEFLVGFDVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPHLIELLIISKEVDKELIIPNRLRACMKLTADEL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF14
13-827 PTHR11017:SF14

IGNYLIEEASMFMAVKEDLEELKTELTCIHGYLKDVEAREREDEVSKEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDDIKILKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIRLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYPSEKCKNKRMRSFLNFGELEFLVGFDVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPHLIELLIISKEVDKELIIPNRLRA

HMMPanther: PTHR11017
13-827 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGNYLIEEASMFMAVKEDLEELKTELTCIHGYLKDVEAREREDEVSKEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDDIKILKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIRLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYPSEKCKNKRMRSFLNFGELEFLVGFDVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPHLIELLIISKEVDKELIIPNRLRA

HMMPanther: PTHR11017:SF14
13-827 PTHR11017:SF14

IGNYLIEEASMFMAVKEDLEELKTELTCIHGYLKDVEAREREDEVSKEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDDIKILKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIRLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYPSEKCKNKRMRSFLNFGELEFLVGFDVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPHLIELLIISKEVDKELIIPNRLRA

HMMPanther: PTHR11017
13-827 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGNYLIEEASMFMAVKEDLEELKTELTCIHGYLKDVEAREREDEVSKEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDDIKILKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIRLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYPSEKCKNKRMRSFLNFGELEFLVGFDVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPHLIELLIISKEVDKELIIPNRLRA

superfamily: SSF52540
146-397 SSF52540

LRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDD

superfamily: SSF52540
146-397 SSF52540

LRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDD

HMMPfam: PF00931
IPR002182
169-450 NB-ARC,NBS
NB-ARC

DAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIRLLVAEGFIQG

HMMPfam: PF00931
IPR002182
169-450 NB-ARC,NBS
NB-ARC

DAKILLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKLRFLTFEESWELFEQRAFRNIQRKDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKTPSEWNDVCNSLWRRLKDDSIHVAPIVFDLSFKELRHESKLCFLYLSIFPEDYEIDLEKLIRLLVAEGFIQG

Gene3D: G3DSA:3.40.50.300
173-318 G3DSA:3.40.50.300

LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRF

Gene3D: G3DSA:3.40.50.300
173-318 G3DSA:3.40.50.300

LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSRVIITTRIKAVAEGVDGRF

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

IISIFGMGGLGKTALA

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

IISIFGMGGLGKTALA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

LLEGKKYLVVVDDIW

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

LLEGKKYLVVVDDIW

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CRGLPLCIVVLAGLL

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CRGLPLCIVVLAGLL

superfamily: SSF52058
487-812 SSF52058,LRR

RIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYPSEKCKNKRMRSFLNFGELEFLVGFDVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPHLIELLIIS

superfamily: SSF52058
487-812 SSF52058,LRR

RIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYPSEKCKNKRMRSFLNFGELEFLVGFDVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPHLIELLIIS

Gene3D: G3DSA:3.80.10.10
559-804 G3DSA:3.80.10.10

DVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPH

Gene3D: G3DSA:3.80.10.10
559-804 G3DSA:3.80.10.10

DVETLKLLRVLDLGRLRFPLKINGDLIHLRYLGIGGHSLRYIAAITFKLRFLQTLDASDIHFIRETIDLRKLTSLRHVIGKFVGELLIGDAANLQTLRSISFDSWNKLKPELLINLRDLFIYEDYTPKERRVPMSWASLTKLRSLRVLKLQAYGIYLLFESEEAVRSMDVISPSLESVTLFGITFKEDPMPFFQKMPRLEDLILENCHYSGGKMSVSEQGFGRLRKLHLAMASLDELQIGGEAMPH

FPrintScan: PR00364
IPR000767
561-577 DISEASERSIST
Disease resistance protein

ETLKLLRVLDLGRLRFP

FPrintScan: PR00364
IPR000767
561-577 DISEASERSIST
Disease resistance protein

ETLKLLRVLDLGRLRFP

PatternScan: PS00014
833-836 ER_TARGET,Endoplasmic reticulum targeting sequence.

ADEL

PatternScan: PS00014
833-836 ER_TARGET,Endoplasmic reticulum targeting sequence.

ADEL


List of References

Sharon A Hall, Rebecca L Allen, Rachel E Baumber, Laura A Baxter, Kate Fisher, Peter D Bittner-Eddy, Laura E Rose, Eric B Holub, Jim L Beynon
Maintenance of genetic variation in plants and pathogens involves complex networks of gene-for-gene interactions.
Mol. Plant Pathol.: 2009, 10(4);449-57
PubMed:19523099 WorldCat.org DOI (I p)

Sharon A Hall, Rebecca L Allen, Rachel E Baumber, Laura A Baxter, Kate Fisher, Peter D Bittner-Eddy, Laura E Rose, Eric B Holub, Jim L Beynon
Maintenance of genetic variation in plants and pathogens involves complex networks of gene-for-gene interactions.
Mol. Plant Pathol.: 2009, 10(4);449-57
PubMed:19523099 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox