PRGDB00061749 (disease resistance protein, putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12323020 (AC058785)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC F13N6 genomic sequence, complete sequence.

DNA Sequence

CCACTTGCAAATCTCAAGGAGATGAACTTGTGTGGGTCATCTTGTTTGAAGGAACTCCCAGATCTTTCGAAAGCAGCAAATCTGGAGAGATTGGATGTGGCTGAGTGCAATGCTTTGGTAGAGATTCCATCCTCAGTTGCGAATCTTCACAAAATAGTTAACTTACACATGGAATCCTGTGAAAGTCTAGAAGTCATTCCAACTCTCATCAACTTGGCATCTCTTAAGATTATCAACATACATGATTGCCCACGGTTGAAAAGTTTTCCAGATGTTCCCACCAGCCTCGAGGAACTTGTGATAGAGAAAACAGGGGTACAAGAATTGCCTGCATCATTTAGGCATTGCACTGGTGTTACTACTCTTTATATATGTTCCAATAGAAATCTCAAGACCTTCTCAACACATCTCCCCATGGGTCTAAGGAAGCTAGACCTAAGCAATTGTGGTATTGAGTGGGTTACAGATAGCATCAAAGATCTTCATAATCTATATTACCTTAAACTATCAGGCTGCAAAAGACTTGTGTCTTTGCCAGAACTCCCTTGTTCGCTCGAGTGTCTATTTGCAGAGGATTGTACATCACTAGAAAGAGTAAGTGACTCTCTAAACATTCCAAATGCGCAGTTCAATTTCATCAAATGCTTCACATTGGATAGAGAAGCACGACGAGCGATTATTCAACAATCGTTTGTTCATGGGAATGTTATCTTACCAGCAAGAGAAGTACTTGAAGAAGTCGATTACCGAGCGAGAGGAAATTGCTTAACAATTCCTCCTTCTGCTTTCAACAGATTTAAGGTTTGCGTTGTGTTGTCAATTCACTAGGGTAAAGGATCAGCTTTAGGATTATCATTGGACGTAGCAGAGATCAAAGAATTAGTAATAAACAAAAAGGCTTTTAAAAAAATGTGCAATCTTCTCATCTTAAAAGTCTTTAATGGGACGGATCCCCGAGATAGTAAATTGCACGTACCAGAGGAGATGGAGCTTCCATCTAGCATAAGGTTACTACATTGGGAGGCATACCCGAGAAAATCTTTTAGATTTGGTCCAGAAAATCTCGTCACACTCAACATGGAGTACAGTGAGCTCGAGAAGCTATGGAAAGGAACTCAGGCCCAATGAAGCTAAAATGATCGAGAAGATTGCAAGAGATGTTTCAGATATACTAAACGTCACACCGTGTAGGGATTTTGATGGCATGGTTGGACTAAACGATCATTTGAGGGAAATGGAGTCTTTGCTAGATTTAAAGAATGATGGAGTTAAGATTGTTGGAATCTCTGGTCCTGCAGGCATTGGTAAAAGTACCATTGCTACAGCTTTACATGGTCGACTCTCTAACATGTTTCAGCGTACTTGTTTTGTGGACAATCTTAGGGAAAGCTATAAGATTGGTCTTGATGAGTATCGTTTGAAGTTGCACTTACAACAGCAACTTCTTGCATATGTTTTAAATCAGGATAAAATTAGGGTGGGCCATTTAAGTGTGATGAAAGAAAGGCTTGACGACTTGAGGGTTCTTATTATTCTTGATGATGTGGAGCATCTATATCAACTAGAGGCTTTGGCTGATATCAGGTGGTTTGGTCCTGGAAGTAGGGTGATAGTGACCACTGAAAACAGAGAGATTTTGCTGCAACATGGTATCAAGGATATATACCATGTGGGTTTTCCATCAGAAGGAGAAGCTCTAATGATCTTTTGTCTATCTGCTTTTAGACAACCCTCTCCACCTTATGGTTTTTTGAAGCTTACATATGAAGTTGCAAGTATTTGTGGTAATCTTCCATTGGGTCTGCATGTTTTGGGGACGTTATTGTGGGGAAAAAGTCAGGCTGACTGGATTGAAGAACTACCAAGGTTGAAAGACTGTCTTGATGGAAGAATTGAGAGTGTATTGAAAGTTGGCTATGAGAGTTTATATGAGAAAGACCAAGCTCTTTTTCTCCTCATTGCAGTCTACTTCAATTATGATTATGTTGATTATGTGACATCCATGCTAGAAAATACTAACGTATTGGATGTTAGACTTGGGTTGAAAAAACTAGCTAATAGATGTCTTATACAAATAGATATAGACCATAATCGCAAAAGTAGAGTCGTAATGAACCGGTTGCTACAAGTAATGGCTCGAGAAGTTATTTCCAAACAAAAAATTTCCAAACGAAAGATTCTAGAAGATCCCCAGGATATTTGTTATGTTCTAGAAGAGGCAAAGATGGCTTCTTCTTCTTCCTCACCTCGCAACTGGAGATACAATGTCTTCACGAGCTTCCATGGACCAGACGTCCGTATTAAATTTCTCAGTCATTTACGTCAACAGTTTATTTACAATGGAATTACTATGTTCGATGACAACGGGATCGAAAGAAGCCAAATTATCGCTCCAGCTCTCAAAAAAGCCATTGGAGAATCGAGGATCGCGATCTTATTGCTCTCGAAGAACTATGCTTCTTCCAGTTGGTCTTTGGATGAGCTATTGGAGATTTTAAAGTGCAAAGAAGATATAGGGCAAATAGTGATGACTGTCTTCTACGAAGTTGATCCTTCTGATGTCCGCAACCAAACCGGAGATTTTGGGATTGCTTTTAAAGAAACTTGTGCTCATAAAACAGAGGAGGAGAGGCAAAAATGGACCCAAGCTTTGACCTATGTGGGCAACATTGCCGGAGAAGACTTTAAACACTG


Protein sequences

Name Description Sequence
disease resistance protein, putative disease resistance protein, putative [Arabidopsis thaliana].

MASSSSSPRNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVVLSIH

disease resistance protein, putative disease resistance protein, putative [Arabidopsis thaliana].

MASSSSSPRNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVVLSIH

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll-Interleukin receptor

MASSSSSPRNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGE

superfamily: SSF52200
IPR000157
1-152 TIR
Toll-Interleukin receptor

MASSSSSPRNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGE

Gene3D: G3DSA:3.40.50.10140
9-143 G3DSA:3.40.50.10140

RNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQAL

Gene3D: G3DSA:3.40.50.10140
9-143 G3DSA:3.40.50.10140

RNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQAL

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll-Interleukin receptor

WRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNI

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll-Interleukin receptor

WRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNI

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll-Interleukin receptor

RYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNI

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll-Interleukin receptor

RYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNI

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll-Interleukin receptor

VFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALT

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll-Interleukin receptor

VFTSFHGPDVRIKFLSHLRQQFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALT

HMMPanther: PTHR11017:SF20
35-896 PTHR11017:SF20,SUBFAMILY NOT NAMED

QFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVVLSI

HMMPanther: PTHR11017
35-896 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVVLSI

HMMPanther: PTHR11017:SF20
35-896 PTHR11017:SF20,SUBFAMILY NOT NAMED

QFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVVLSI

HMMPanther: PTHR11017
35-896 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFIYNGITMFDDNGIERSQIIAPALKKAIGESRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVVLSI

superfamily: SSF52540
66-435 SSF52540

SRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFL

superfamily: SSF52540
66-435 SSF52540

SRIAILLLSKNYASSSWSLDELLEILKCKEDIGQIVMTVFYEVDPSDVRNQTGDFGIAFKETCAHKTEEERQKWTQALTYVGNIAGEDFKHWPNEAKMIEKIARDVSDILNVTPCRDFDGMVGLNDHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFL

HMMPfam: PF00931
IPR002182
191-445 NB-ARC,NBS
NB-ARC

DHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDY

HMMPfam: PF00931
IPR002182
191-445 NB-ARC,NBS
NB-ARC

DHLREMESLLDLKNDGVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSEGEALMIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDY

Gene3D: G3DSA:3.40.50.300
201-216 G3DSA:3.40.50.300

DLKNDGVKIVGISGPA

Gene3D: G3DSA:3.40.50.300
201-216 G3DSA:3.40.50.300

DLKNDGVKIVGISGPA

HMMSmart: SM00382
IPR003593
206-345 AAA,NBS
ATPase, AAA+ type, core

GVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPS

HMMSmart: SM00382
IPR003593
206-345 AAA,NBS
ATPase, AAA+ type, core

GVKIVGISGPAGIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIGLDEYRLKLHLQQQLLAYVLNQDKIRVGHLSVMKERLDDLRVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPS

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

IVGISGPAGIGKSTIA

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

IVGISGPAGIGKSTIA

Gene3D: G3DSA:3.40.50.300
217-251 G3DSA:3.40.50.300

GIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIG

Gene3D: G3DSA:3.40.50.300
217-251 G3DSA:3.40.50.300

GIGKSTIATALHGRLSNMFQRTCFVDNLRESYKIG

Gene3D: G3DSA:3.40.50.300
263-279 G3DSA:3.40.50.300

QQLLAYVLNQDKIRVGH

Gene3D: G3DSA:3.40.50.300
263-279 G3DSA:3.40.50.300

QQLLAYVLNQDKIRVGH

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

RLDDLRVLIILDDVE

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

RLDDLRVLIILDDVE

Gene3D: G3DSA:3.40.50.300
291-346 G3DSA:3.40.50.300

RVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSE

Gene3D: G3DSA:3.40.50.300
291-346 G3DSA:3.40.50.300

RVLIILDDVEHLYQLEALADIRWFGPGSRVIVTTENREILLQHGIKDIYHVGFPSE

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

CGNLPLGLHVLGTLL

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

CGNLPLGLHVLGTLL

superfamily: SSF46785
413-522 SSF46785

GRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLE

superfamily: SSF46785
413-522 SSF46785

GRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLE

superfamily: SSF52058
517-832 SSF52058,LRR

ICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQF

superfamily: SSF52058
517-832 SSF52058,LRR

ICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQF

Gene3D: G3DSA:3.80.10.10
535-827 G3DSA:3.80.10.10

LDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNI

Gene3D: G3DSA:3.80.10.10
535-827 G3DSA:3.80.10.10

LDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNI

HMMPfam: PF07725
IPR011713
603-622 LRR_3
Leucine-rich repeat 3

NLVTLNMEYSELEKLWKGTQ

HMMPfam: PF07725
IPR011713
603-622 LRR_3
Leucine-rich repeat 3

NLVTLNMEYSELEKLWKGTQ

HMMPfam: PF13504
763-774 LRR_7,Leucine rich repeat

LRKLDLSNCGIE

HMMPfam: PF13504
763-774 LRR_7,Leucine rich repeat

LRKLDLSNCGIE

FPrintScan: PR00364
IPR000767
781-797 DISEASERSIST
Disease resistance protein

KDLHNLYYLKLSGCKRL

FPrintScan: PR00364
IPR000767
781-797 DISEASERSIST
Disease resistance protein

KDLHNLYYLKLSGCKRL

HMMPfam: PF13504
784-801 LRR_7,Leucine rich repeat

HNLYYLKLSGCKRLVSLP

HMMPfam: PF13504
784-801 LRR_7,Leucine rich repeat

HNLYYLKLSGCKRLVSLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox