PRGDB00061752 (disease resistance protein RPP1-WsA, putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP1-WsA, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 9994129 (AC079733)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC T8L23 genomic sequence, complete sequence.

DNA Sequence

ATGGTCCCGTGGTCCGCGACGGTTAGTGGTGCTGTTAATATTTCTAACACATCAAACTATACTCTTAGTGATTATATATTAACAAGACGTATGTATAAATTGATCTTCTTCTTTGTTAGGGTTGATGAAACAGACATGATTGAAAACATCGCCGCTTATATTTCCAGCCGTTTCCAGAATAGCGCAGTCATCGAGGATATCAAAGGAAGCTATCCAAAACCTCGTTTTGATGAGGATCTTCAAATCTTCTGCAAGTATGCTTTTAACCAAAAGACCCCTGAAGATGGTTTCGATGAACTAGCTCGTGAAATTACATACCATGTCGGTGAACTTCCGTTAGGACTAAAGGTTATTGGATCCCACTTTCGTGGATTGTCCAAGGAGCAGTGGCCAATGGAAGTATCAAGGTTAAGGACGTACCGTAATGGAGATATTGAGCGCATTTTGAAGTTCAGTTATGATGCTTTATGTGATGAAGATAAAGATTTATTCCTTCATATAGCTTGCTTTTTCAACATGGAAAAAATAACGAAAGTGAAAGAACTTTTTGGCCACAGATTCAAGGATTTGAGACAAAGCCTTCACATTTTAGAGATGAAATCTCTTATATCTATTGAACATACTGATCTTGAAGATTCCGAGTATTATGAGTCCATAAACATGCGTAACTTGCTGGTCCAACTAGGTCAAGAAATCGTCCGTAAAGAATCCGTTCTTGAGCCTGGTCAACGCCGATTTTTGATTGATTATAAAGATATTTGTGCAGTAGTCTCTGGTCATACAACAATTACTGGAAGTGTTGTAGGCATAGACTCCAAGAATTGGTTAAGTATAACTGAGAAATCCTTTAAAGGAATGTCTAATCTCCAGTTCTTAAGAGTCAAAAACGATTTATATCATCCAAACATTATATCTTCTCCGGGACCTCTGACTTTTATATCCCCGAAGCTACGATTACTAGATTGGTCGTGTTTCCCGATGACATCTTTGCGTTTTATTAATAATCTGGAATTCCTTGTCGAATTAAGGATGTGTTACAGCAAACTTGAGAAGCTGTGGGACGGAATTCAACTGGTTAGAAATCTCAAGCATATGGATTTGACAGATTCTAGAAACCTGAAGGAGCTTCCTAATCTCTCAATGGCTACTAATCTTAAGAATTTAAACCTTGAAAGATGTTCAAGTCTGGTGGAGCTTCCTTCCTCTATTGGAAATGCAACTAGTCTCCATGACTTAAGACTTTTTAAATGTTCTAGTCTGGTGGAGCTCCCTTTTTCAATTGGGAATTTAACTAATCTTTGGAAATTAGATCTTCGTGAATGTTCAAGTCTTGTATCACTCCCGCAGCTTCCAGATTCCATAATGGTCCTAAATGCACGAAATTGCGAGTCCCTAGAGAAACTAGATTGCTCCTTTTACAATCCAGGTATTCTTCTCAACTTCGTTAACTGCTTCAACCTAAATCAAGAAGCAAGAGATCTCCTCATCGAGACATCAACTGTTAATTTTGTGGTCTTACCTGGTAAAGAAGTGCCTGCGTGCTTCACTTACAGAAGTCATGGGAGTTCCGTATCAGTGAAGGTTAATCAAAAGCTTCTTCATACGTCAACCAAATTTAAGGCTTGCATCTTGTTTGAGAACGAGGTCGATAATGAAACTTATTATTTTGATTTGGACACACTTTGTGTGTATACGAAGACGAATAAGGATTGCATCTTGTTGGATAATAAAGGTGAAGATGATGAGGTTGGTATTCAGAAACGAGGGTTGGTGTCTTGTCGCATCGGTTCCGAATGGCGTTTCTCTGAATGGTATCCATTTATAACGGATCATCTATACATTTTCGAAGTTGAAGCAAAGGAGGTGACTTCCACAGAGCTTATTTTTTATTTCGAGATATTCGATGAGTATTCCAAGGCTAGGGAGATAAAAGAATGCGGGATAATCCACCTCTTGGAACATCATGTTGACGACGAAGAAAAGATGGATACAATTGAGAAGGAACCCAAGTCGGAAATTTTCAAAAACTTTGAAGTTGCTATCGATATCTCAAAATGCGTTAAGTCGAGGAAACGTATAGGAGCTAGAACCAACCTGGATGCTAAGGAGATCTGCGAGACAATTCAGTAA


Protein sequences

Name Description Sequence
disease resistance protein RPP1-WsA, putative disease resistance protein RPP1-WsA, putative [Arabidopsis thaliana].

MVPWSATVSGAVNISNTSNYTLSDYILTRRMYKLIFFFVRVDETDMIENIAAYISSRFQNSAVIEDIKGSYPKPRFDEDLQIFCKYAFNQKTPEDGFDELAREITYHVGELPLGLKVIGSHFRGLSKEQWPMEVSRLRTYRNGDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKVKELFGHRFKDLRQSLHILEMKSLISIEHTDLEDSEYYESINMRNLLVQLGQEIVRKESVLEPGQRRFLIDYKDICAVVSGHTTITGSVVGIDSKNWLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFYNPGILLNFVNCFNLNQEARDLLIETSTVNFVVLPGKEVPACFTYRSHGSSVSVKVNQKLLHTSTKFKACILFENEVDNETYYFDLDTLCVYTKTNKDCILLDNKGEDDEVGIQKRGLVSCRIGSEWRFSEWYPFITDHLYIFEVEAKEVTSTELIFYFEIFDEYSKAREIKECGIIHLLEHHVDDEEKMDTIEKEPKSEIFKNFEVAIDISKCVKSRKRIGARTNLDAKEICETIQ

disease resistance protein RPP1-WsA, putative disease resistance protein RPP1-WsA, putative [Arabidopsis thaliana].

MVPWSATVSGAVNISNTSNYTLSDYILTRRMYKLIFFFVRVDETDMIENIAAYISSRFQNSAVIEDIKGSYPKPRFDEDLQIFCKYAFNQKTPEDGFDELAREITYHVGELPLGLKVIGSHFRGLSKEQWPMEVSRLRTYRNGDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKVKELFGHRFKDLRQSLHILEMKSLISIEHTDLEDSEYYESINMRNLLVQLGQEIVRKESVLEPGQRRFLIDYKDICAVVSGHTTITGSVVGIDSKNWLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFYNPGILLNFVNCFNLNQEARDLLIETSTVNFVVLPGKEVPACFTYRSHGSSVSVKVNQKLLHTSTKFKACILFENEVDNETYYFDLDTLCVYTKTNKDCILLDNKGEDDEVGIQKRGLVSCRIGSEWRFSEWYPFITDHLYIFEVEAKEVTSTELIFYFEIFDEYSKAREIKECGIIHLLEHHVDDEEKMDTIEKEPKSEIFKNFEVAIDISKCVKSRKRIGARTNLDAKEICETIQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
74-682 PTHR11017:SF20,SUBFAMILY NOT NAMED

PRFDEDLQIFCKYAFNQKTPEDGFDELAREITYHVGELPLGLKVIGSHFRGLSKEQWPMEVSRLRTYRNGDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKVKELFGHRFKDLRQSLHILEMKSLISIEHTDLEDSEYYESINMRNLLVQLGQEIVRKESVLEPGQRRFLIDYKDICAVVSGHTTITGSVVGIDSKNWLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFYNPGILLNFVNCFNLNQEARDLLIETSTVNFVVLPGKEVPACFTYRSHGSSVSVKVNQKLLHTSTKFKACILFENEVDNETYYFDLDTLCVYTKTNKDCILLDNKGEDDEVGIQKRGLVSCRIGSEWRFSEWYPFITDHLYIFEVEAKEVTSTELIFYFEIFDEYSKAREIKECGIIHLLEHHVDDEEKMDTIEKEPKSEIFKNFEVAID

HMMPanther: PTHR11017
74-682 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PRFDEDLQIFCKYAFNQKTPEDGFDELAREITYHVGELPLGLKVIGSHFRGLSKEQWPMEVSRLRTYRNGDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKVKELFGHRFKDLRQSLHILEMKSLISIEHTDLEDSEYYESINMRNLLVQLGQEIVRKESVLEPGQRRFLIDYKDICAVVSGHTTITGSVVGIDSKNWLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFYNPGILLNFVNCFNLNQEARDLLIETSTVNFVVLPGKEVPACFTYRSHGSSVSVKVNQKLLHTSTKFKACILFENEVDNETYYFDLDTLCVYTKTNKDCILLDNKGEDDEVGIQKRGLVSCRIGSEWRFSEWYPFITDHLYIFEVEAKEVTSTELIFYFEIFDEYSKAREIKECGIIHLLEHHVDDEEKMDTIEKEPKSEIFKNFEVAID

HMMPanther: PTHR11017:SF20
74-682 PTHR11017:SF20,SUBFAMILY NOT NAMED

PRFDEDLQIFCKYAFNQKTPEDGFDELAREITYHVGELPLGLKVIGSHFRGLSKEQWPMEVSRLRTYRNGDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKVKELFGHRFKDLRQSLHILEMKSLISIEHTDLEDSEYYESINMRNLLVQLGQEIVRKESVLEPGQRRFLIDYKDICAVVSGHTTITGSVVGIDSKNWLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFYNPGILLNFVNCFNLNQEARDLLIETSTVNFVVLPGKEVPACFTYRSHGSSVSVKVNQKLLHTSTKFKACILFENEVDNETYYFDLDTLCVYTKTNKDCILLDNKGEDDEVGIQKRGLVSCRIGSEWRFSEWYPFITDHLYIFEVEAKEVTSTELIFYFEIFDEYSKAREIKECGIIHLLEHHVDDEEKMDTIEKEPKSEIFKNFEVAID

HMMPanther: PTHR11017
74-682 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PRFDEDLQIFCKYAFNQKTPEDGFDELAREITYHVGELPLGLKVIGSHFRGLSKEQWPMEVSRLRTYRNGDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKVKELFGHRFKDLRQSLHILEMKSLISIEHTDLEDSEYYESINMRNLLVQLGQEIVRKESVLEPGQRRFLIDYKDICAVVSGHTTITGSVVGIDSKNWLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFYNPGILLNFVNCFNLNQEARDLLIETSTVNFVVLPGKEVPACFTYRSHGSSVSVKVNQKLLHTSTKFKACILFENEVDNETYYFDLDTLCVYTKTNKDCILLDNKGEDDEVGIQKRGLVSCRIGSEWRFSEWYPFITDHLYIFEVEAKEVTSTELIFYFEIFDEYSKAREIKECGIIHLLEHHVDDEEKMDTIEKEPKSEIFKNFEVAID

HMMPfam: PF00931
IPR002182
77-179 NB-ARC,NBS
NB-ARC

DEDLQIFCKYAFNQKTPEDGFDELAREITYHVGELPLGLKVIGSHFRGLSKEQWPMEVSRLRTYRNGDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKV

HMMPfam: PF00931
IPR002182
77-179 NB-ARC,NBS
NB-ARC

DEDLQIFCKYAFNQKTPEDGFDELAREITYHVGELPLGLKVIGSHFRGLSKEQWPMEVSRLRTYRNGDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKV

FPrintScan: PR00364
IPR000767
108-122 DISEASERSIST
Disease resistance protein

VGELPLGLKVIGSHF

FPrintScan: PR00364
IPR000767
108-122 DISEASERSIST
Disease resistance protein

VGELPLGLKVIGSHF

superfamily: SSF46785
143-258 SSF46785

GDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKVKELFGHRFKDLRQSLHILEMKSLISIEHTDLEDSEYYESINMRNLLVQLGQEIVRKESVLEPGQRRFLIDYKDICAVVS

superfamily: SSF46785
143-258 SSF46785

GDIERILKFSYDALCDEDKDLFLHIACFFNMEKITKVKELFGHRFKDLRQSLHILEMKSLISIEHTDLEDSEYYESINMRNLLVQLGQEIVRKESVLEPGQRRFLIDYKDICAVVS

superfamily: SSF52058
232-474 SSF52058,LRR

IVRKESVLEPGQRRFLIDYKDICAVVSGHTTITGSVVGIDSKNWLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFYN

superfamily: SSF52058
232-474 SSF52058,LRR

IVRKESVLEPGQRRFLIDYKDICAVVSGHTTITGSVVGIDSKNWLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFYN

Gene3D: G3DSA:3.80.10.10
275-473 G3DSA:3.80.10.10

WLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFY

Gene3D: G3DSA:3.80.10.10
275-473 G3DSA:3.80.10.10

WLSITEKSFKGMSNLQFLRVKNDLYHPNIISSPGPLTFISPKLRLLDWSCFPMTSLRFINNLEFLVELRMCYSKLEKLWDGIQLVRNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLVELPSSIGNATSLHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVSLPQLPDSIMVLNARNCESLEKLDCSFY

HMMPfam: PF07725
IPR011713
338-357 LRR_3
Leucine-rich repeat 3

FLVELRMCYSKLEKLWDGIQ

HMMPfam: PF07725
IPR011713
338-357 LRR_3
Leucine-rich repeat 3

FLVELRMCYSKLEKLWDGIQ

FPrintScan: PR00364
IPR000767
428-444 DISEASERSIST
Disease resistance protein

GNLTNLWKLDLRECSSL

FPrintScan: PR00364
IPR000767
428-444 DISEASERSIST
Disease resistance protein

GNLTNLWKLDLRECSSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox