PRGDB00061760 (disease resistance protein, putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 10998935 (AC069299)
Gene Class RPW8-NL
Domain Type NBS, LRR, RPW8, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC T1E4 genomic sequence, complete sequence.

DNA Sequence

GGGAAATGGATGAAATGAATTGGTTTGACATGGACCTCCCTAAGGCAGAAGTTTTAATACTGAACTTCTCTTCGGACAACTACGTCTTGCCACCATTTATTGGTAAGATGAGTAGACTCAGGGTGCTCGTGATTATCAACAATGGCATGTCTCCTGCGCGTCTACATGGCTTCTCCATCTTTGCCAATTTGGCCAAACTGAGGAGTCTCTGGCTCAAGAGGGTACATGTCCCTGAACTCACCAGCTGCACCATTCCACTGAAAAACCTGCACAAGATACATCTAATCTTTTGTAAGGTCAAGAACAGCTTTGTTCAGACGTCATTCGACATCTCGAAAATATTCCCAAGCTTGTCTGATCTCACTATTGATCACTGTGATGATCTTTTGGAACTAAAATCCATATTTGGAATAACCTCTCTCAACTCTCTCAGCATAACCAACTGTCCACGGATTCTTGAATTGCCCAAGAATTTGAGTAACGTACAGTCCCTTGAACGTCTAAGGTTATATGCCTGCCCCGAGCTGATATCCCTCCCGGTCGAAGTTTGTGAGCTGCCATGTCTAAAGTACGTTGACATTTCACAGTGTGTCAGCCTGGTTTCTCTTCCTGAAAAGTTTGGAAAGCTAGGGAGTCTTGAGAAAATTGACATGAGAGAATGCAGTTTATTGGGTTTACCAAGTTCTGTAGCTGCACTTGTGTCTCTACGCCATGTCATTTGCGATGAGGAGACTTCGTCTATGTGGGAAATGGTCAAGAAGGTGGTTCCTGAACTTTGCATTGAAGTCGCCAAAAAATGCTTCACCGTGGATTGGCTTGACGATTAGGTTTGGCGATGTGCACATTGGCTACTATGATGTATTTGTGACGCAACACGATGTTTTGAGAGACCTAGCCCTTCATATGTCCAATCGTGTGGACGTAAATAGGAGAGAGCGGTTATTAATGCCAAAAACAGAGCCAGTGCTTCCAAGAGAATGGGAAAAGAATAAAGATGAGCCATTTGATGCCAAGATAGTTTCCCTTCATACAGGCAAGACTTCTTTAACTTTAAATGAATTTGGTTGTTGATGAGTGTAAAGGTTTACCTTTATCTTTGAAAGTTCTTGGTGCTTCGTTAAAAAACAAACCTGAAAGATATTGGGAAGGCGTAGTGAAGAGGTTATTAAGAGGAGAAGCTGCTGATGAAACTCATGAGAGCAGAGTGTTTGCTCATATGGAAGAAAGTCTAGAAAACCTCGACCCGAAAATCCGAGACTGTTTCTTGGATATGGGTGCTTTCCCTGAAGACAAGAAGATCCCTCTTGATCTTCTCACGAGCGTGTGGGTTGAGAGGCATGATATTGACGAGGAAACTGCGTTTTCCTTTGTTCTTCGTTTAGCTGACAAGAATCTCCTTACTATAGTGAACAATCCGAGGACTCTTTAAGAATAAGGTTTTGTTTTTGACTGTGTCACGGTCTCCGAATTTTGAGAATTTGGAGTCTTGTATACGAGAATTTCTTTATGATGGAGTTCATCAACGGAAGCTAGTGATTCTTGATGATGTTTGGACAAGGGAGTCCTTGGACAGGCTGATGTCTAAAATTCGTGGAAGCACTACTTTAGTAGTGTCACGGTCCAAGCTTGCAGATCCTAGAACCACCTACAATGTGGAATTATTAAAGAAAGATGAAGCAATGTCTCTTTTGTGTCTCTGTGCTTTCGAACAAAAGTCCCCGCCTTCTCCATTCAACAAATATTTGGTGAAGCAGATGGCTTCGTTCATAGATCTTTTCGCCGGCGACATCACGACGCAACTCTTAAAGCTGCTCGCTCTAGTAGCTAACACAGTCTACAGTTGCAAAGGAATCGCCGAACGACTGATCACGATGATCAGAGACGTTCAACCAACGATCAGGGAGATCCAATACAGTGGCGCGGAGCTGAGTAACCATCACCAAACTCAACTGGGAGTATTCTATGAGATCTTGGAGAAAGCAAGAAAGCTATGTGAAAAGGTTTTAAGATGCAATAGGTGGAACCTTAAACATGTGTACCACGCGAATAAGATGAAGGATCTCGAGAAACAAATATCTCGTTTCCTCAACAGCCAGATTTTGCTCTTTGTTCTTGCTGAGGTATGTCATCTACGGGTCAATGGTGACAGGATTGAGAGGAATATGGATAGACTGTTGACTGAGCGGAATGATTCTTTGTCGTTTCCGGAGACTATGATGGAGATTGAGACGGTAAGCGATCCGGAGATTCAGACGGTATTGGAATTGGGGAAGAAAAAGGTGAAGGAGATGATGTTTAAGTTTACGGATACACATTTGTTTGGGATCTCTGGAATGAGCGGTTCAGGGAAAACCACTCTTGCAATAGAGCTTTCAAAGGACGATGATGTTCGAG


Protein sequences

Name Description Sequence
disease resistance protein, putative disease resistance protein, putative [Arabidopsis thaliana].

MASFIDLFAGDITTQLLKLLALVANTVYSCKGIAERLITMIRDVQPTIREIQYSGAELSNHHQTQLGVFYEILEKARKLCEKVLRCNRWNLKHVYHANKMKDLEKQISRFLNSQILLFVLAEVCHLRVNGDRIERNMDRLLTERNDSLSFPETMMEIETVSDPEIQTVLELGKKKVKEMMFKFTDTHLFGISGMSGSGKTTLAIELSKDDDVRGLFKNKVLFLTVSRSPNFENLESCIREFLYDGVHQRKLVILDDVWTRESLDRLMSKIRGSTTLVVSRSKLADPRTTYNVELLKKDEAMSLLCLCAFEQKSPPSPFNKYLVKQVVDECKGLPLSLKVLGASLKNKPERYWEGVVKRLLRGEAADETHESRVFAHMEESLENLDPKIRDCFLDMGAFPEDKKIPLDLLTSVWVERHDIDEETAFSFVLRLADKNLLTIVNNPRFGDVHIGYYDVFVTQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGKTSLTLNEFGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALVSLRHVICDEETSSMWEMVKKVVPELCIEVAKKCFTVDWLDD

disease resistance protein, putative disease resistance protein, putative [Arabidopsis thaliana].

MASFIDLFAGDITTQLLKLLALVANTVYSCKGIAERLITMIRDVQPTIREIQYSGAELSNHHQTQLGVFYEILEKARKLCEKVLRCNRWNLKHVYHANKMKDLEKQISRFLNSQILLFVLAEVCHLRVNGDRIERNMDRLLTERNDSLSFPETMMEIETVSDPEIQTVLELGKKKVKEMMFKFTDTHLFGISGMSGSGKTTLAIELSKDDDVRGLFKNKVLFLTVSRSPNFENLESCIREFLYDGVHQRKLVILDDVWTRESLDRLMSKIRGSTTLVVSRSKLADPRTTYNVELLKKDEAMSLLCLCAFEQKSPPSPFNKYLVKQVVDECKGLPLSLKVLGASLKNKPERYWEGVVKRLLRGEAADETHESRVFAHMEESLENLDPKIRDCFLDMGAFPEDKKIPLDLLTSVWVERHDIDEETAFSFVLRLADKNLLTIVNNPRFGDVHIGYYDVFVTQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGKTSLTLNEFGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALVSLRHVICDEETSSMWEMVKKVVPELCIEVAKKCFTVDWLDD

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-149 RPW8
Powdery mildew resistance protein, RPW8 domain

MASFIDLFAGDITTQLLKLLALVANTVYSCKGIAERLITMIRDVQPTIREIQYSGAELSNHHQTQLGVFYEILEKARKLCEKVLRCNRWNLKHVYHANKMKDLEKQISRFLNSQILLFVLAEVCHLRVNGDRIERNMDRLLTERNDSLS

ProfileScan: PS51153
IPR008808
1-149 RPW8
Powdery mildew resistance protein, RPW8 domain

MASFIDLFAGDITTQLLKLLALVANTVYSCKGIAERLITMIRDVQPTIREIQYSGAELSNHHQTQLGVFYEILEKARKLCEKVLRCNRWNLKHVYHANKMKDLEKQISRFLNSQILLFVLAEVCHLRVNGDRIERNMDRLLTERNDSLS

HMMPfam: PF05659
IPR008808
16-128 RPW8
Powdery mildew resistance protein, RPW8 domain

LLKLLALVANTVYSCKGIAERLITMIRDVQPTIREIQYSGAELSNHHQTQLGVFYEILEKARKLCEKVLRCNRWNLKHVYHANKMKDLEKQISRFLNSQILLFVLAEVCHLRV

HMMPfam: PF05659
IPR008808
16-128 RPW8
Powdery mildew resistance protein, RPW8 domain

LLKLLALVANTVYSCKGIAERLITMIRDVQPTIREIQYSGAELSNHHQTQLGVFYEILEKARKLCEKVLRCNRWNLKHVYHANKMKDLEKQISRFLNSQILLFVLAEVCHLRV

superfamily: SSF52540
164-361 P-loop containing nucleoside triphosphate hydrolases

EIQTVLELGKKKVKEMMFKFTDTHLFGISGMSGSGKTTLAIELSKDDDVRGLFKNKVLFLTVSRSPNFENLESCIREFLYDGVHQRKLVILDDVWTRESLDRLMSKIRGSTTLVVSRSKLADPRTTYNVELLKKDEAMSLLCLCAFEQKSPPSPFNKYLVKQVVDECKGLPLSLKVLGASLKNKPERYWEGVVKRLLR

superfamily: SSF52540
164-361 P-loop containing nucleoside triphosphate hydrolases

EIQTVLELGKKKVKEMMFKFTDTHLFGISGMSGSGKTTLAIELSKDDDVRGLFKNKVLFLTVSRSPNFENLESCIREFLYDGVHQRKLVILDDVWTRESLDRLMSKIRGSTTLVVSRSKLADPRTTYNVELLKKDEAMSLLCLCAFEQKSPPSPFNKYLVKQVVDECKGLPLSLKVLGASLKNKPERYWEGVVKRLLR

Gene3D: G3DSA:3.40.50.300
174-208 no description

KKVKEMMFKFTDTHLFGISGMSGSGKTTLAIELSK

Gene3D: G3DSA:3.40.50.300
174-208 no description

KKVKEMMFKFTDTHLFGISGMSGSGKTTLAIELSK

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

LFGISGMSGSGKTTLA

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

LFGISGMSGSGKTTLA

HMMPfam: PF00931
IPR002182
232-416 NB-ARC,NBS
NB-ARC

ENLESCIREFLYDGVHQRKLVILDDVWTRESLDRLMSKIRGSTTLVVSRSKLADPRTTYNVELLKKDEAMSLLCLCAFEQKSPPSPFNKYLVKQVVDECKGLPLSLKVLGASLKNKPERYWEGVVKRLLRGEAADETHESRVFAHMEESLENLDPKIRDCFLDMGAFPEDKKIPLDLLTSVWVER

HMMPfam: PF00931
IPR002182
232-416 NB-ARC,NBS
NB-ARC

ENLESCIREFLYDGVHQRKLVILDDVWTRESLDRLMSKIRGSTTLVVSRSKLADPRTTYNVELLKKDEAMSLLCLCAFEQKSPPSPFNKYLVKQVVDECKGLPLSLKVLGASLKNKPERYWEGVVKRLLRGEAADETHESRVFAHMEESLENLDPKIRDCFLDMGAFPEDKKIPLDLLTSVWVER

FPrintScan: PR00364
IPR000767
330-344 DISEASERSIST
Disease resistance protein

CKGLPLSLKVLGASL

FPrintScan: PR00364
IPR000767
330-344 DISEASERSIST
Disease resistance protein

CKGLPLSLKVLGASL

HMMPanther: PTHR24420:SF764
395-749 ADR1 (ACTIVATED DISEASE RESISTANCE 1)

MGAFPEDKKIPLDLLTSVWVERHDIDEETAFSFVLRLADKNLLTIVNNPRFGDVHIGYYDVFVTQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGKTSLTLNEFGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLP

HMMPanther: PTHR24420
395-749 FAMILY NOT NAMED,FAMILY NOT NAMED

MGAFPEDKKIPLDLLTSVWVERHDIDEETAFSFVLRLADKNLLTIVNNPRFGDVHIGYYDVFVTQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGKTSLTLNEFGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLP

HMMPanther: PTHR24420:SF764
395-749 ADR1 (ACTIVATED DISEASE RESISTANCE 1)

MGAFPEDKKIPLDLLTSVWVERHDIDEETAFSFVLRLADKNLLTIVNNPRFGDVHIGYYDVFVTQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGKTSLTLNEFGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLP

HMMPanther: PTHR24420
395-749 FAMILY NOT NAMED,FAMILY NOT NAMED

MGAFPEDKKIPLDLLTSVWVERHDIDEETAFSFVLRLADKNLLTIVNNPRFGDVHIGYYDVFVTQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGKTSLTLNEFGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLP

superfamily: SSF52058
458-765 L domain-like,LRR

TQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGKTSLTLNEFGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALVSLRHVICDE

superfamily: SSF52058
458-765 L domain-like,LRR

TQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGKTSLTLNEFGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALVSLRHVICDE

Gene3D: G3DSA:3.80.10.10
540-761 no description

VLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALVSLRHV

Gene3D: G3DSA:3.80.10.10
540-761 no description

VLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALVSLRHV

FPrintScan: PR00364
IPR000767
730-746 DISEASERSIST
Disease resistance protein

GKLGSLEKIDMRECSLL

FPrintScan: PR00364
IPR000767
730-746 DISEASERSIST
Disease resistance protein

GKLGSLEKIDMRECSLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox