PRGDB00061763 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 10716598 (AC026815)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 10 BAC OSJNBa0079L16 genomic sequence, complete sequence.

DNA Sequence

GAGCCATTCCTCCAAGCCTTGCTGGTATATCTACCCTTAGGTAACTCATTGTCTGAATGCATCCCCGATGAGTTAACAAACCTCCAAGGCCTTCGATTTCTGAACTTGTCAAGGAACAATCTATCCGCTAAAGGGATGCCAGACGCTGGTCACTTTAGATATTGGGAACAACAATTTCTTTGGTGGCATTCCTCCTTGGATTGGGAAAGGCCTTTCATCTTTGAAGATTCTTAGCCTTAGATCAAACAACTTCACCGATGGCAGCCAAGGCCCCTCTCGTGCTGCGCCTCTGTCTCTTCCTCTGCATCTCCCTCTCCCTCTTGCTGTTATCATCTCCTCAACGGGTGACGAGCTTGAGCCTCGATGCCGATGTGGACGATCACTACTACCATTACGATGGGGACGAAGACGATGACAACTACTACCATGATGACGACGACGACGTCTTCTCCGGCAGGCCGGTACGGAGAATATACGACGGCGACGACGACGAAAACTACTACCGCAATGATGAAGTAGACTTCTCCAGCAGGCCGGCTCGGAGGCTATACGACGGCGGCGCAGTCATGCCGGAGAAGTACAACGTCCTGAACGGCAACTCCTCCAACAGCAGCTCCGGCTCGGCCTTTTGCAGGTTGCTTTCTCTCCAGATCCTGGACCTGTCAAACAACAAGCTCACCGGTAAGCTGCCTGACTGCTGGTGGAATCTGCAGAGCCTGCAGTTCATGGACCTCTCCCACAACCGCTTCTCAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa Japonica Group].

MAAKAPLVLRLCLFLCISLSLLLLSSPQRVTSLSLDADVDDHYYHYDGDEDDDNYYHDDDDDVFSGRPVRRIYDGDDDENYYRNDEVDFSSRPARRLYDGGAVMPEKYNVLNGNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRFSALKGCQTLVTLDIGNNNFFGGIPPWIGKGLSSLKILSLRSNNFTGNSLSECIPDELTNLQGLRFLNLSRNNLSSHSSKPCWYIYP

putative disease resistance protein putative disease resistance protein [Oryza sativa Japonica Group].

MAAKAPLVLRLCLFLCISLSLLLLSSPQRVTSLSLDADVDDHYYHYDGDEDDDNYYHDDDDDVFSGRPVRRIYDGDDDENYYRNDEVDFSSRPARRLYDGGAVMPEKYNVLNGNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRFSALKGCQTLVTLDIGNNNFFGGIPPWIGKGLSSLKILSLRSNNFTGNSLSECIPDELTNLQGLRFLNLSRNNLSSHSSKPCWYIYP


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
111-240 G3DSA:3.80.10.10

LNGNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRFSALKGCQTLVTLDIGNNNFFGGIPPWIGKGLSSLKILSLRSNNFTGNSLSECIPDELTNLQGLRFLNLSRNNLSSH

superfamily: SSF52058
111-242 SSF52058,LRR

LNGNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRFSALKGCQTLVTLDIGNNNFFGGIPPWIGKGLSSLKILSLRSNNFTGNSLSECIPDELTNLQGLRFLNLSRNNLSSHSS

HMMPanther: PTHR24420
111-239 PTHR24420,FAMILY NOT NAMED

LNGNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRFSALKGCQTLVTLDIGNNNFFGGIPPWIGKGLSSLKILSLRSNNFTGNSLSECIPDELTNLQGLRFLNLSRNNLSS

Gene3D: G3DSA:3.80.10.10
111-240 G3DSA:3.80.10.10

LNGNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRFSALKGCQTLVTLDIGNNNFFGGIPPWIGKGLSSLKILSLRSNNFTGNSLSECIPDELTNLQGLRFLNLSRNNLSSH

superfamily: SSF52058
111-242 SSF52058,LRR

LNGNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRFSALKGCQTLVTLDIGNNNFFGGIPPWIGKGLSSLKILSLRSNNFTGNSLSECIPDELTNLQGLRFLNLSRNNLSSHSS

HMMPanther: PTHR24420
111-239 PTHR24420,FAMILY NOT NAMED

LNGNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRFSALKGCQTLVTLDIGNNNFFGGIPPWIGKGLSSLKILSLRSNNFTGNSLSECIPDELTNLQGLRFLNLSRNNLSS

HMMPfam: PF13855
113-164 LRR_8,Leucine rich repeat

GNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRF

HMMPfam: PF13855
113-164 LRR_8,Leucine rich repeat

GNSSNSSSGSAFCRLLSLQILDLSNNKLTGKLPDCWWNLQSLQFMDLSHNRF

FPrintScan: PR00019
130-143 LEURICHRPT,Leucine-rich repeat signature

LQILDLSNNKLTGK

FPrintScan: PR00019
130-143 LEURICHRPT,Leucine-rich repeat signature

LQILDLSNNKLTGK

FPrintScan: PR00019
151-164 LEURICHRPT,Leucine-rich repeat signature

LQSLQFMDLSHNRF

FPrintScan: PR00019
151-164 LEURICHRPT,Leucine-rich repeat signature

LQSLQFMDLSHNRF

HMMPfam: PF13516
170-185 LRR_6,Leucine Rich repeat

CQTLVTLDIGNNNFFG

HMMPfam: PF13516
170-185 LRR_6,Leucine Rich repeat

CQTLVTLDIGNNNFFG

HMMPfam: PF00560
IPR001611
197-224 LRR_1
Leucine-rich repeat

SLKILSLRSNNFTGNSLSECIPDELTNL

HMMPfam: PF00560
IPR001611
197-224 LRR_1
Leucine-rich repeat

SLKILSLRSNNFTGNSLSECIPDELTNL

HMMPfam: PF00560
IPR001611
227-239 LRR_1
Leucine-rich repeat

LRFLNLSRNNLSS

HMMPfam: PF00560
IPR001611
227-239 LRR_1
Leucine-rich repeat

LRFLNLSRNNLSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox