PRGDB00061764 (10716598)

From PRG Wiki
Jump to: navigation, search
10716598
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 10716598 (AC026815)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 10 BAC OSJNBa0079L16 genomic sequence, complete sequence.

DNA Sequence

TAAAAAGAGAGGGTAAAGGAGATTTATCGCGGGTAGAAGACGATGGTCACCTCAATTTCGGACCAAGGAACTCGGGTGCGGGCGAATTCTCGGGATTTGGTGGAGCCGATGGCCGGCGTCGTCTTCCTCGTCCTCTTCGTGGCGGCCGCCGCCATGCCAGCATCGGTCACCGCAGCGACATCACAGACCGATGCGCTGCTGGCGTGGAAGGCCAGCCTGCTGCTGGGCGACGCGGCCGCGCTGTCCGGCTGGACGCGGGCCGCGCCGGTCTGCACCTGGCGCGGCGTGGCCTGCGACGCCGCCGGCCGCGTCACTTCGCTCCGGCTCCGGGACGCCGGTCTCAGCGGCGGCCTCGACACGCTCGACTTCGCGGCGCTCCCGGCGCTGACCGAGCTTGACCTCAACAGGAACAACTTCACCGGTCCCATCCCGGCCAGCATCTCGCGGCTGCGCTCCCTTTCTTTGCTCGATCTCGGCAGCAACTGGTTGGATGGCTCTATACCGCCGCAGCTCGGCGACCTCTCCGGCCTCGTCGAGCTTCGCCTCTACAACAACAACCTCGTCGGCGCCATCCCCCACCAGTTAAGCCGTCTCCCCAACATTGTCCATTTCGATCTGGGAGCAAACTACCTGACCGACCATGACTTCCGCAAGTTCTCGCCGATGCCCACCGTCACGTTCATGTCGCTCTACCTCAACTCCTTCAATGGAAGCTTCCCGGAGTTCGTCCTCAGGAGCGGCAGCATCACCTACCTCGACCTGTCGCAGAATGCTCTGTTCGGGCCAATACCGGACATGCTCCCGAATCTGAGGTTCCTCAACCTGTCCTTCAATGCGTTCTCCGGCCCGATTCCGGCGTCGCTTGGGAGGTTGACGAAGCTCCAGGACCTGCGAATGGCCGGCAACAATCTCACCGGCGGCGTCCCGGAGTTCCTCGGGTCGATGGCACAGTTGAGGATTCTTGAGCTCGGGGACAACCAGCTCGGCGGTCCAATCCCGTCGGTTCTTGGCCAGCTCCAGATGCTTCAGAGGCTCGACATCAAGAACGCTAGCCTTGTTTCAACTTTGCCGCCTCAACTAGGCAATCTTAATAATCTCGCTTATCTGGACCTGTCCTTGAACCAGTTCTCCGGTGGGTTGCCGCCGACGTTTGCAGGGATGCGGGCAATGCAGGAGTTCGGCCTTTCCACGACCAATGTCACTGGTGAGATCCCACCGGCGTTGTTCACGAGCTGGCCCGAGCTCATATCCTTCGAAGTGCAGAACAACTCGTTCACCGGCAAGATTCCATCGGAGCTCGGCAAGGCGAGGAAACTGGAAATCCTTTACCTATTCCTGAACAACCTTAACGGTTCCATCCCGGCAGAGCTTGGCGAGTTGGAGAACCTGGTAGAGCTGGATTTGTCGGTGAACTCGCTCACCGGACCGATCCCCAGCTCGCTCGGCAACCTCAAGCAGCTCATAAAGTTGGCGCTATTCTTCAACAATCTCACCGGCGTAATCCCGCCGGAGATTGGCAACATGACGGCGTTGCAAAGCTTCGACGTCAACACCAACATTCTGCACGGCGAGCTGCCAGCCACCATCACGGCCCTCAAGAACCTCCAATACCTCGCCGTGTTCGACAACTTCATGAGCGGCACCATCCCGCCGGACCTCGGCAAGGGCATAGCCTTGCAGCACGTGAGCTTCAGCAACAACAGTTTCTCTGGCGAGCTGCCACGGAACCTCTGCGACGGCTTCGCGCTGGAGCACTTCACGGTGAACTACAACAACTTCACCGGCACGCTGCCACCGTGCCTGAAGAACTGCACGGGGCTGTTCAGGGTTCGGCTAGAGGAGAACCACTTCACCGGCGACATCTCGGAGGCCTTCGGCGTGCACCCCAGCCTGGAGTACCTGGACATCTCCGGCAACAAGCTTACTGGTGAGCTGTCCTCCGACTGGGGACAGTGTACCAACCTCACGCTCCTGAGCATGGACGGCAATCGCATATCCGGCCGCATTCCTGAAGCATTTGGGAGCATGACAAGATTGCAGATTCTCAGCTTGGCTGGAAACAATCTGACAGGAGGTATTCCACTTGATTTGGGTCATCTCAACCTTTTGTTCAATCTCAACCTGAGCCATAATTCCTTTTCCGGGCCTATCCCGACAAGTTTGGGCAACAATTCTAAGCTACAGAAAATAGATATGTCAGGAAACATGCTTAATGGCACGATACCAGTTGCTCTTGGCAAGCTTGGTGCTCTGACATTTCTTGATTTGAGCAAGAACAGGTTGTCAGGGAAGATACCAAGGGAACTTGGTAATCTGGTTCAGCTGCAGACCCTACTTGATTTGAGCAGCAATTTTTTATCGGGTTGGATCCCCCAGGCAGCCTTCTGCAAACTGCTCTCTCTTCAGATTCTGATCCTGTCGAACAACCAGCTGACTGGAAAACTGCCCGACTGCCTATGGTACTTGCAAAATCTGCAGTTCTTGGACCTTTCCAACAATGCATTCTCAGGTGAAATCCCTGCAGCAAAGGCAAGCTACAGTTGTTCCCTTATATCGATTCATCTTTCCAGCAATGACTTCACTGGAGTTTTTCCATCAGCGTTAGAGGGATGCAAGAAGTTGATCAATTTAGATATTGGGAATAACAATTTTTTTGGTGATATTCCTATTTGGATTGGGAAAGGCCTTCCATCATTGAAGATTCTTAGCCTTAAATCAAACAACTTCAGTGGTGAAATTCCATCAGAGTTGTCACAGCTTTCTCAACTTCAACTGCTAGACATGACCAACAATGGTTTGACAGGGTTGATTCCCAGATCTTTTGGTAAACTTACTTCCATGAAGAATCCAAAGCTTATATCTAGTCGGGAATTATTACAATGGTCTTTTAATCATGATAGAATCAATACAATCTGGAAGGGGAAGGAGCAAATATTTGAAATAAAGACTTATGCAATAGATATTCAATTAGTGACGGGTATCAGTTTGTCAGGTAACTCATTATCACAATGCATCCCTGATGAATTAATGAACCTCCAAGGCCTTCAATTTCTGAACTTGTCAAGAAACTATCTGTCACGCAGCATACCTGAGAACATTGGTAGTTTGAAAAATCTTGAGTCTCTTGACCTATCATCAAACGAACTTTCAGGAGCCATTCCTCCAAGCCTTGCCGGTATATCTACCCTTAGCAGTCTGAATCTCTCGAATAATCATCTATCAGGCAAGATATCCACCGGGAATCAACTTCAAACCCTCACTGACCCATCAATCTACAGCAACAATTCTGGGCTATGTGGCCTTCCGTTGAACATCTCATGCACAAATTATGCACTTGCATCAGACGAGAGATATTGTAGAACATGCGAGGACCAGTATCTATCGTACTTTGTGATGGCTGGAGTGGTTTTTGGGTCTTGGCTATGGTTTGGAATGTTATTTTCAATTGGGAACTTAAGGTATGCCGTTTTCTGCTTTGTTGATGACATTCAGCGTAAGGTTATGCAGAAGGTGTCCT


Protein sequences

Name Description Sequence
putative disease resistance protein (3' partial) putative disease resistance protein (3' partial) [Oryza sativa Japonica Group].

MAGVVFLVLFVAAAAMPASVTAATSQTDALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTDPSIYSNNSGLCGLPLNISCTNYALASDERYCRTCEDQYLSYFVMAGVVFGSWLWFGMLFSIGNLRYAVFCFVDDIQRKVMQKVSLKREGKGDLSRVEDDGHLNFGPRNSGAGEFSGFGGA

putative disease resistance protein (3' partial) putative disease resistance protein (3' partial) [Oryza sativa Japonica Group].

MAGVVFLVLFVAAAAMPASVTAATSQTDALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTDPSIYSNNSGLCGLPLNISCTNYALASDERYCRTCEDQYLSYFVMAGVVFGSWLWFGMLFSIGNLRYAVFCFVDDIQRKVMQKVSLKREGKGDLSRVEDDGHLNFGPRNSGAGEFSGFGGA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-1064 PTHR24420,FAMILY NOT NAMED

MAGVVFLVLFVAAAAMPASVTAATSQTDALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTDPSIYSNNSGLCG

HMMPanther: PTHR24420:SF504
1-1064 PTHR24420:SF504,OS10G0469000 PROTEIN

MAGVVFLVLFVAAAAMPASVTAATSQTDALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTDPSIYSNNSGLCG

HMMPanther: PTHR24420
1-1064 PTHR24420,FAMILY NOT NAMED

MAGVVFLVLFVAAAAMPASVTAATSQTDALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTDPSIYSNNSGLCG

HMMPanther: PTHR24420:SF504
1-1064 PTHR24420:SF504,OS10G0469000 PROTEIN

MAGVVFLVLFVAAAAMPASVTAATSQTDALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTDPSIYSNNSGLCG

HMMPfam: PF08263
IPR013210
25-63 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SQTDALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACD

HMMPfam: PF08263
IPR013210
25-63 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SQTDALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACD

Gene3D: G3DSA:3.80.10.10
54-323 G3DSA:3.80.10.10

VCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQ

Gene3D: G3DSA:3.80.10.10
54-323 G3DSA:3.80.10.10

VCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQ

superfamily: SSF52047
70-415 SSF52047,LRR

SLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNG

superfamily: SSF52047
70-415 SSF52047,LRR

SLRLRDAGLSGGLDTLDFAALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPNIVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALFGPIPDMLPNLRFLNLSFNAFSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNG

HMMPfam: PF00560
IPR001611
93-114 LRR_1
Leucine-rich repeat

LTELDLNRNNFTGPIPASISRL

HMMPfam: PF00560
IPR001611
93-114 LRR_1
Leucine-rich repeat

LTELDLNRNNFTGPIPASISRL

HMMPfam: PF00560
IPR001611
233-255 LRR_1
Leucine-rich repeat

NLRFLNLSFNAFSGPIPASLGRL

HMMPfam: PF00560
IPR001611
233-255 LRR_1
Leucine-rich repeat

NLRFLNLSFNAFSGPIPASLGRL

Gene3D: G3DSA:3.80.10.10
376-596 G3DSA:3.80.10.10

WPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLE

Gene3D: G3DSA:3.80.10.10
376-596 G3DSA:3.80.10.10

WPELISFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLE

superfamily: SSF52047
416-742 SSF52047,LRR

SIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTL

superfamily: SSF52047
416-742 SSF52047,LRR

SIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTL

HMMPfam: PF00560
IPR001611
426-448 LRR_1
Leucine-rich repeat

NLVELDLSVNSLTGPIPSSLGNL

HMMPfam: PF00560
IPR001611
426-448 LRR_1
Leucine-rich repeat

NLVELDLSVNSLTGPIPSSLGNL

HMMPfam: PF12799
593-630 LRR_4,Leucine Rich repeats (2 copies)

PSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRIS

HMMPfam: PF12799
593-630 LRR_4,Leucine Rich repeats (2 copies)

PSLEYLDISGNKLTGELSSDWGQCTNLTLLSMDGNRIS

Gene3D: G3DSA:3.80.10.10
597-746 G3DSA:3.80.10.10

YLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLS

Gene3D: G3DSA:3.80.10.10
597-746 G3DSA:3.80.10.10

YLDISGNKLTGELSSDWGQCTNLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLS

HMMPfam: PF00560
IPR001611
642-664 LRR_1
Leucine-rich repeat

RLQILSLAGNNLTGGIPLDLGHL

HMMPfam: PF00560
IPR001611
642-664 LRR_1
Leucine-rich repeat

RLQILSLAGNNLTGGIPLDLGHL

superfamily: SSF52058
656-1059 SSF52058,LRR

GIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTDPSIYSNN

superfamily: SSF52058
656-1059 SSF52058,LRR

GIPLDLGHLNLLFNLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTDPSIYSNN

HMMPfam: PF00560
IPR001611
715-736 LRR_1
Leucine-rich repeat

LTFLDLSKNRLSGKIPRELGNL

FPrintScan: PR00019
715-728 LEURICHRPT,Leucine-rich repeat signature

LTFLDLSKNRLSGK

HMMPfam: PF00560
IPR001611
715-736 LRR_1
Leucine-rich repeat

LTFLDLSKNRLSGKIPRELGNL

FPrintScan: PR00019
715-728 LEURICHRPT,Leucine-rich repeat signature

LTFLDLSKNRLSGK

HMMPfam: PF13855
742-798 LRR_8,Leucine rich repeat

LLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNA

HMMPfam: PF13855
742-798 LRR_8,Leucine rich repeat

LLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNA

Gene3D: G3DSA:3.80.10.10
747-913 G3DSA:3.80.10.10

SNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKN

Gene3D: G3DSA:3.80.10.10
747-913 G3DSA:3.80.10.10

SNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKN

HMMPfam: PF13855
813-873 LRR_8,Leucine rich repeat

SLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNF

HMMPfam: PF13855
813-873 LRR_8,Leucine rich repeat

SLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNF

HMMPfam: PF00560
IPR001611
886-908 LRR_1
Leucine-rich repeat

QLQLLDMTNNGLTGLIPRSFGKL

HMMPfam: PF00560
IPR001611
886-908 LRR_1
Leucine-rich repeat

QLQLLDMTNNGLTGLIPRSFGKL

Gene3D: G3DSA:3.80.10.10
958-1052 G3DSA:3.80.10.10

ISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTD

Gene3D: G3DSA:3.80.10.10
958-1052 G3DSA:3.80.10.10

ISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTD

HMMPfam: PF13855
978-1037 LRR_8,Leucine rich repeat

GLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHL

HMMPfam: PF13855
978-1037 LRR_8,Leucine rich repeat

GLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHL

FPrintScan: PR00019
1000-1013 LEURICHRPT,Leucine-rich repeat signature

LKNLESLDLSSNEL

FPrintScan: PR00019
1000-1013 LEURICHRPT,Leucine-rich repeat signature

LKNLESLDLSSNEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox