PRGDB00061765 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12408712 (AC009177)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome III BAC T12H1 genomic sequence, complete sequence.

DNA Sequence

ATGATTCCAAGCCAATCTTGCTTCTGTTTTTTCTTCATGGTTTCATTCTTTCTACACACTCTTGCTTCTCCTACGCTTCGCCATTGCCGCCATGACCAAAGGAATGCTCTTCTGGAGTTCAAACACGAGTTTCCGCGGGTAAATGAATCCAACCAAATTCCTTATGATGTATCGTTAAGTTCATGGAACAAGAGCATTGATTGTTGTTCTTGGGAGGGTGTCACGTGCGATGCTATATCTAGCGAGGTGATTTCACTTAACCTTAGTCATGTTCCTCTTAATAACTCATTGAAACCAAATAGTGGTCTTTTCAAACTTCAACATCTTCATAACTTAACCCTTAGTAATTGTAGTCTCTATGGAGATATTCCTTCTTCATTAGGAAACCTTTTTCGTCTCACACTTCTTGACCTTTCGTATAATTATTTAGTTGGTCAAGTTCCACCTTCTATAGGAAACCTTTCTCGACTCACAATTCTTGACCTTTGGGATAATAAGTTAGTAGGTCAACTTCCAGCTTCAATAGGAAACCTAACCCAACTAGAATACTTGATCTTTTCACACAACAAATTCAGTGGCAATATTCCTGTTACATTCTCCAATTTAACAAAACTGCTCGTTGTCAACCTCTATAATAATTCCTTCGAATCCATGCTCCCACTTGACATGAGTGGATTCCAAAACTTGGACTATTTTAATGTTGGTGAAAACTCATTTTCCGGGACTTTGCCTAAATCTTTGTTCACAATTCCTTCATTACGTTGGGCTAATTTAGAGGGAAACATGTTCAAGGGACCTATAGAGTTTAGGAATATGTATTCACCATCTACTAGGCTTCAATATCTATTTCTTTCTCAAAACAAATTTGATGGCCCAATCCCTGATACTCTATCCCAATATCTCAATCTCATAGAGTTAGATCTTAGTTTCAACAATCTAACTGGATCTTTCCCTACGTTCTTGTTCACAATTCCCACGTTAGAAAGGGTTAACTTAGAGGGAAACCATCTCAAGGGACCTGTAGAGTTTGGAAACATGTCTTCATCGTCTAGTCTCAAGTTTCTAAACTTTGCTCAAAACGAATTCAATGGCTCGATCCCCGAATCTGTATCTCAGTATCTCAATCTTGAAGAGCTACATCTTAGTTTCAACAATTTCATTGGTACAATCCCAAGATCTATATCAAAGTTAGCCAAACTTGAATATTTTTGTCTTGAAGACAATAATATGGTAGGTGAAGTACCAAGTTGGCTATGGAGATTGACAATGGTGGCACTTTCTAACAATTCTTTCAACAGTTTTGGAGAATCATCAGAAGGTCTTGATGAAACACAAGTTCAGTGGTTGGATCTTAGTTCAAATTCATTTCAAGGACCATTTCCTCATTGGATATGCAAGCTTAGATCGTTGGAGATCTTAATTATGTCCGATAATCGCTTCAACGGCTCAATTCCTCCATGTTTAAGCAGCTTCATGGTTTCTCTTACAGATTTAATTCTACGTAACAACAGTTTGAGTGGACCTCTTCCTGATATATTTGTCAATGCGACAAAGCTACTATCACTTGACGTTAGTCGCAACAAGTTGGATGGAGTACTACCAAAATCTTTGATCCATTGCAAAGCTATGCAACTTTTGAATGTGAGAAGCAACAAAATCAAGGACAAGTTTCCTTCTTGGTTAGGATCTCTACCGTCATTACATGTCCTCATCCTACGATCAAATGAGTTTTATGGGACGTTGTATCAACCCCATGCATCCATTGGGTTTCAAAGTTTAAGAGTCATTGATGTCTCACACAATGACTTGATTGGGACGTTACCGTCATTCTATTTTTCTAGTTGGCGTGAAATGAGCAGATTAACAGGAGAAGATGGCGACTTTAGACTTTCTGAGGCTCCATACATGGGAAAAGTTTTGAATGCTACTGCATTCTTTGTTGATTCAATGGAAATCGTGAACAAAGGAGTAGAGACGGAGTTTAAGCGGATCAACGAAGAAAACAAAGTCATAAACTTTTCTGGAAACAGATTTTCTGGAAATATACCTGAATCCATTGGATTGTTGAAAGAGTTACGTCATCTCAACTTGTCAAGTAATGCATTCACAGGAAATATCCCACAATCATTGGCAAATTTGATGAAGCTTGAGGCGTTAGACTTATCTCTGAATCAGTTGTCTGGTCAAATTCCTCAAGGACTTGGTAGTCTCTCGTTTATGTCAACAATGAACTTCTCTTACAACTTTCTTGAAGGTCCAGTGCCTAAAAGCACACAGTTCCAAGGTCAAAACTGTTCTGCATTCATGGAAAACCCCAAGCTCAATGGTCTCGAGGAAATATGTAGAGAAACTGATCGTGTCCCGAATCCAAAACCACAAGAATCAAAAGATTTGTCTGAGCCGGAAGAACATGTGATTAACTGGATAGCCGCGGGAATAGCTTATGGTCCTGGTGTCGTCTGTGGATTGGTAATTGGACATATATTCCTTTCACACAAACACGAGTGTTGGTTCATGGAAAAGTTTCGTCGAAAAAAGCCCAAAGTAGTCACCAGAATTGCTCGTCCCTCTAAGCATTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MIPSQSCFCFFFMVSFFLHTLASPTLRHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRETDRVPNPKPQESKDLSEPEEHVINWIAAGIAYGPGVVCGLVIGHIFLSHKHECWFMEKFRRKKPKVVTRIARPSKH

putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MIPSQSCFCFFFMVSFFLHTLASPTLRHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRETDRVPNPKPQESKDLSEPEEHVINWIAAGIAYGPGVVCGLVIGHIFLSHKHECWFMEKFRRKKPKVVTRIARPSKH


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF913
9-839 PTHR24420:SF913

CFFFMVSFFLHTLASPTLRHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRETDRVPNPKPQESKDLSEPEEHVINWIAAGIAYGPGVVCGLVIGHIFLSHKHECWFM

HMMPanther: PTHR24420
9-839 PTHR24420,FAMILY NOT NAMED

CFFFMVSFFLHTLASPTLRHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRETDRVPNPKPQESKDLSEPEEHVINWIAAGIAYGPGVVCGLVIGHIFLSHKHECWFM

HMMPanther: PTHR24420:SF913
9-839 PTHR24420:SF913

CFFFMVSFFLHTLASPTLRHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRETDRVPNPKPQESKDLSEPEEHVINWIAAGIAYGPGVVCGLVIGHIFLSHKHECWFM

HMMPanther: PTHR24420
9-839 PTHR24420,FAMILY NOT NAMED

CFFFMVSFFLHTLASPTLRHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRETDRVPNPKPQESKDLSEPEEHVINWIAAGIAYGPGVVCGLVIGHIFLSHKHECWFM

superfamily: SSF52058
27-347 SSF52058,LRR

RHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMS

superfamily: SSF52058
27-347 SSF52058,LRR

RHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMS

Gene3D: G3DSA:3.80.10.10
29-272 G3DSA:3.80.10.10

CRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNM

Gene3D: G3DSA:3.80.10.10
29-272 G3DSA:3.80.10.10

CRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNM

HMMPfam: PF08263
IPR013210
31-77 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

HDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCD

HMMPfam: PF08263
IPR013210
31-77 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

HDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCD

HMMPfam: PF00560
IPR001611
132-154 LRR_1
Leucine-rich repeat

RLTLLDLSYNYLVGQVPPSIGNL

HMMPfam: PF00560
IPR001611
132-154 LRR_1
Leucine-rich repeat

RLTLLDLSYNYLVGQVPPSIGNL

HMMPfam: PF13855
155-214 LRR_8,Leucine rich repeat

SRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNS

HMMPfam: PF13855
155-214 LRR_8,Leucine rich repeat

SRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNS

Gene3D: G3DSA:3.80.10.10
277-426 G3DSA:3.80.10.10

TRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVAL

Gene3D: G3DSA:3.80.10.10
277-426 G3DSA:3.80.10.10

TRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVAL

superfamily: SSF52047
297-502 SSF52047,LRR

LSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRN

superfamily: SSF52047
297-502 SSF52047,LRR

LSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRN

HMMPfam: PF00560
IPR001611
302-319 LRR_1
Leucine-rich repeat

NLIELDLSFNNLTGSFPT

HMMPfam: PF00560
IPR001611
302-319 LRR_1
Leucine-rich repeat

NLIELDLSFNNLTGSFPT

FPrintScan: PR00019
303-316 LEURICHRPT,Leucine-rich repeat signature

LIELDLSFNNLTGS

FPrintScan: PR00019
303-316 LEURICHRPT,Leucine-rich repeat signature

LIELDLSFNNLTGS

HMMPfam: PF00560
IPR001611
375-397 LRR_1
Leucine-rich repeat

NLEELHLSFNNFIGTIPRSISKL

HMMPfam: PF00560
IPR001611
375-397 LRR_1
Leucine-rich repeat

NLEELHLSFNNFIGTIPRSISKL

Gene3D: G3DSA:3.80.10.10
427-619 G3DSA:3.80.10.10

SNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMS

Gene3D: G3DSA:3.80.10.10
427-619 G3DSA:3.80.10.10

SNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMS

superfamily: SSF52058
492-783 SSF52058,LRR

MVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRE

superfamily: SSF52058
492-783 SSF52058,LRR

MVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRE

HMMPfam: PF13855
494-553 LRR_8,Leucine rich repeat

SLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKI

HMMPfam: PF13855
494-553 LRR_8,Leucine rich repeat

SLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKI

Gene3D: G3DSA:3.80.10.10
670-772 G3DSA:3.80.10.10

VINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENP

Gene3D: G3DSA:3.80.10.10
670-772 G3DSA:3.80.10.10

VINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENP

HMMPfam: PF00560
IPR001611
692-713 LRR_1
Leucine-rich repeat

LRHLNLSSNAFTGNIPQSLANL

HMMPfam: PF00560
IPR001611
692-713 LRR_1
Leucine-rich repeat

LRHLNLSSNAFTGNIPQSLANL

FPrintScan: PR00019
713-726 LEURICHRPT,Leucine-rich repeat signature

LMKLEALDLSLNQL

FPrintScan: PR00019
713-726 LEURICHRPT,Leucine-rich repeat signature

LMKLEALDLSLNQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox