PRGDB00061770 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12408720 (AC009991)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome III BAC F9F8 genomic sequence, complete sequence.

DNA Sequence

ATGAAAGGCTCTTGGGTGGTCTCAACGAGTATCATTCGTATTACTCTTTCTTTTACTTTCTTATTCATTTGTCATTTTTCGGACGTGCTTGCGGCTCCTACTAGGCACTTGTGTCGTCCCGAACAAAAGGATGCACTTCTCAAGTTCAAAAACGAGTTTGAGATTGGGAAGCCTTCTCCTACTTGTAAGATGGTTGGCATTGAATCTCATCGGAAGACGGAGTCATGGGGGAATAACAGCGACTGTTGTAATTGGGAGGGAGTCACGTGCAATGCCAAGTCCGGGGAAGTGATCGAGCTCAACCTTAGCTGCAGCTCCCTCCATGGCCGGTTTCATTCCAACAGCAGTATTCGAAACCTTCATTTCCTAACCACTCTAGACCGTTCACATAATGATTTTGAAGGTCAAATCACGTCTTCAATTGAAAATCTGTCTCATCTCACCTCTCTCGACCTTTCTTATAATCGTTTTTCGGGTCAGATTCTGAATTCAATCGGAAACCTTTCTCGTCTCACCTCTCTCGACCTTTCTTTTAATCAGTTTTCGGGTCAGATTCCATCATCAATTGGTAATCTTTCTCATCTCACCTTTCTAGGTCTTTCTGGTAATCGTTTTTTTGGTCAGATTCCATCTTCAATTGGTAATCTTTCTCATCTCACCTTTCTAGGTCTTTCTGGTAATCGTTTTTTTGGTCAGTTTCCGTCTTCAATTGGAGGTCTTTCTAATCTCACCAATCTCCACCTTTCTTATAACAAATATTCGGGTCAGATTCCATCTTCGATTGGCAACCTTTCTCAACTTATCGTTCTCTACCTTTCTGTTAACAATTTCTATGGTGAAATCCCATCTTCTTTTGGCAATCTAAACCAGCTGACCCGCTTAGATGTTTCTTTCAACAAGCTCGGTGGAAACTTTCCCAATGTCCTACTAAACTTGACAGGGTTGTCAGTTGTATCACTCTCCAACAATAAGTTCACAGGCACGCTTCCTCCTAATATCACTTCACTATCCAACTTGATGGCTTTTTATGCAAGTGACAACGCCTTCACCGGAACATTCCCTTCTTTTCTCTTCATCATTCCTTCTTTGACTTACCTTGGTTTGAGTGGTAACCAACTCAAAGGCACTCTTGAGTTTGGGAATATATCTTCACCATCTAACCTACAATACCTTAACATTGGCAGCAACAACTTCATAGGACCAATCCCGAGTTCCATTTCCAAATTAATCAACCTTCAGGAACTTGGCATTTCCCATTTAAACACCCAATGTCGCCCAGTTGACTTTAGTATCTTCTCGCATCTCAAGTCGCTTGACGATCTTAGGCTATCCTATTTGACCACCACTACGATTGACTTGAACGATATCTTACCATATTTCAAGACGCTCCGTTCATTGGATCTCTCAGGCAACCTTGTTTCAGCCACAAACAAGTCTTCAGTTTCTTCAGATCCTCCTTCGCAATCGATACAATCTTTGTACTTGTCAGGATGCGGTATCACCGATTTTCCAGAGATCCTAAGAACACAACACGAATTGGGGTTTCTAGACGTTTCCAACAACAAAATCAAAGGTCAAGTTCCTGGCTGGTTATGGACGCTACCAAACTTGTTCTACTTGAATCTTTCCAACAACACTTTCATCGGTTTCCAAAGACCAACGAAACCTGAACCATCTATGGCGTACTTGCTTGGCTCCAACAATAACTTCACCGGCAAGATTCCTTCTTTCATATGTGAGTTGCGTTCTCTATACACTCTCGATTTATCAGACAACAACTTTAGCGGTTCAATCCCTCGTTGTATGGAAAATCTCAAGAGTAATCTTTCAGAACTAAACCTTCGTCAAAATAATCTTAGTGGAGGTTTTCCAGAGCATATTTTCGAAAGTCTAAGGTCGCTTGATGTCGGCCATAACCAGCTTGTGGGAAAGCTTCCAAGATCTTTGAGATTTTTCTCTAATCTTGAAGTTTTGAACGTGGAAAGCAACAGAATCAACGACATGTTTCCGTTCTGGTTGAGTTCTCTACAAAAGCTACAAGTTCTTGTCCTTCGCTCCAATGCATTCCATGGACCAATAAATCAAGCCTTGTTCCCTAAGTTGCGAATCATCGACATATCACATAATCACTTCAATGGAAGTTTGCCGACAGAGTATTTTGTGGAGTGGAGTAGGATGTCATCACTTGGGACATACGAAGATGGGTCGAATGTAAACTACCTGGGATCAGGCTATTACCAAGATTCAATGGTTTTGATGAATAAAGGTGTAGAGTCGGAGCTGGTACGTATCCTCACAATCTACACAGCAGTCGACTTTTCGGGAAACAAATTTGAAGGAGAGATTCCAAAGTCCATCGGTCTATTGAAAGAGCTTCATGTGCTCAACTTGTCAAACAATGCTTTCACCGGCCACATCCCTTCATCTATAGGGAACCTGACAGCTCTCGAGTCGTTGGACGTTTCCCAGAACAAGCTTTATGGAGAAATCCCACAAGAGATAGGGAACCTCTCGTTGCTTTCGTATATGAACTTCTCTCATAACCAGCTTACAGGCCTAGTACCAGGAGGCCAGCAGTTTCTAACGCAGCGTTGCTCTTCCTTTGAAGGTAACTTGGGACTTTTCGGCTCTTCTCTTGAAGAAGTTTGCAGAGATATTCACACGCCAGCATCACATCAACAGTTTGAAACGCCGCAAACAGAGGAAGAAGACGAAGATCTGATTAGTTGGATAGCAGCTGCAATAGGATTCGGACCTGGTATTGCCTTTGGTTTGATGTTTGGATACATACTCGTTTCCTATAAACCAGAGTGGTTCATGAACCCTTTTGGCCGAAACAATCGTAGACGGAAAAGACACACAACAACTCACTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MKGSWVVSTSIIRITLSFTFLFICHFSDVLAAPTRHLCRPEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAIGFGPGIAFGLMFGYILVSYKPEWFMNPFGRNNRRRKRHTTTH

putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MKGSWVVSTSIIRITLSFTFLFICHFSDVLAAPTRHLCRPEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAIGFGPGIAFGLMFGYILVSYKPEWFMNPFGRNNRRRKRHTTTH


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF916
14-950 PTHR24420:SF916

ITLSFTFLFICHFSDVLAAPTRHLCRPEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAIGFGPGIAFGLMFGYILVSYKPEWFMNPFGRNNRRR

HMMPanther: PTHR24420
14-950 PTHR24420,FAMILY NOT NAMED

ITLSFTFLFICHFSDVLAAPTRHLCRPEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAIGFGPGIAFGLMFGYILVSYKPEWFMNPFGRNNRRR

HMMPanther: PTHR24420:SF916
14-950 PTHR24420:SF916

ITLSFTFLFICHFSDVLAAPTRHLCRPEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAIGFGPGIAFGLMFGYILVSYKPEWFMNPFGRNNRRR

HMMPanther: PTHR24420
14-950 PTHR24420,FAMILY NOT NAMED

ITLSFTFLFICHFSDVLAAPTRHLCRPEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAIGFGPGIAFGLMFGYILVSYKPEWFMNPFGRNNRRR

Gene3D: G3DSA:3.80.10.10
39-301 G3DSA:3.80.10.10

RPEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKL

Gene3D: G3DSA:3.80.10.10
39-301 G3DSA:3.80.10.10

RPEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKL

HMMPfam: PF08263
IPR013210
40-91 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCN

HMMPfam: PF08263
IPR013210
40-91 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PEQKDALLKFKNEFEIGKPSPTCKMVGIESHRKTESWGNNSDCCNWEGVTCN

superfamily: SSF52058
81-471 SSF52058,LRR

DCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGN

superfamily: SSF52058
81-471 SSF52058,LRR

DCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGN

HMMPfam: PF13516
144-167 LRR_6,Leucine Rich repeat

LSHLTSLDLSYNRFSGQILNSIGN

HMMPfam: PF13516
144-167 LRR_6,Leucine Rich repeat

LSHLTSLDLSYNRFSGQILNSIGN

HMMPfam: PF13855
169-229 LRR_8,Leucine rich repeat

SRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRF

HMMPfam: PF13855
169-229 LRR_8,Leucine rich repeat

SRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRF

HMMPfam: PF13855
241-301 LRR_8,Leucine rich repeat

SNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKL

HMMPfam: PF13855
241-301 LRR_8,Leucine rich repeat

SNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKL

Gene3D: G3DSA:3.80.10.10
302-547 G3DSA:3.80.10.10

GGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTF

Gene3D: G3DSA:3.80.10.10
302-547 G3DSA:3.80.10.10

GGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTF

HMMPfam: PF13504
361-374 LRR_7,Leucine rich repeat

PSLTYLGLSGNQLK

HMMPfam: PF13504
361-374 LRR_7,Leucine rich repeat

PSLTYLGLSGNQLK

HMMPfam: PF00560
IPR001611
387-409 LRR_1
Leucine-rich repeat

NLQYLNIGSNNFIGPIPSSISKL

HMMPfam: PF00560
IPR001611
387-409 LRR_1
Leucine-rich repeat

NLQYLNIGSNNFIGPIPSSISKL

superfamily: SSF52058
488-871 SSF52058,LRR

QSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGN

superfamily: SSF52058
488-871 SSF52058,LRR

QSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGN

HMMPfam: PF13855
489-545 LRR_8,Leucine rich repeat

SIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNN

HMMPfam: PF13855
489-545 LRR_8,Leucine rich repeat

SIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNN

Gene3D: G3DSA:3.80.10.10
561-619 G3DSA:3.80.10.10

AYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNL

Gene3D: G3DSA:3.80.10.10
561-619 G3DSA:3.80.10.10

AYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNL

HMMPfam: PF00560
IPR001611
583-604 LRR_1
Leucine-rich repeat

SLYTLDLSDNNFSGSIPRCMEN

HMMPfam: PF00560
IPR001611
583-604 LRR_1
Leucine-rich repeat

SLYTLDLSDNNFSGSIPRCMEN

Gene3D: G3DSA:3.80.10.10
620-731 G3DSA:3.80.10.10

SGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGT

Gene3D: G3DSA:3.80.10.10
620-731 G3DSA:3.80.10.10

SGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGT

HMMPfam: PF13855
630-688 LRR_8,Leucine rich repeat

SLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNA

HMMPfam: PF13855
630-688 LRR_8,Leucine rich repeat

SLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNA

Gene3D: G3DSA:3.80.10.10
771-871 G3DSA:3.80.10.10

VDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGN

Gene3D: G3DSA:3.80.10.10
771-871 G3DSA:3.80.10.10

VDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGN

HMMPfam: PF12799
791-827 LRR_4,Leucine Rich repeats (2 copies)

ELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLY

HMMPfam: PF12799
791-827 LRR_4,Leucine Rich repeats (2 copies)

ELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox