PRGDB00061786 (Putative Cf2/Cf5 disease resistance protein homolog)

From PRG Wiki
Jump to: navigation, search
Putative Cf2/Cf5 disease resistance protein homolog
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 19848323 (AC116601)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group chromosome 10 clone OSJNAa0079B05, complete sequence.

DNA Sequence

ATGGATGGCACATCTGCCAAGGTTGTGCTCTTCATCGGCGCCAGCTTTAGCTTCTTCCTCATCACGCATGCTCAGCAACAAGCTACTCGTTGCAGACCACAAGAGAGAGACGCCCTCCTGTCCTTCAAGCAAGGCATCACCAACGACAGTGTGGGCCTCCTCTCCTCATGGCGGAGAGGCCATGGCGATTGCTGCTCATGGGCAGGCATCACCTGTAGCAGCAAGACTGGCCATGTCGTCAAGCTCGATGTCAACAGCTTCCTTACTGATGATTCACCTATGGTTGGCCAGATAAGTCCATCTTTGCTGTCTCTCAACTACTTGCAGTACCTCGACCTCAGCTCAAACTTGCTGGCAGGGCCTAACGGCAGTGTCCCAGAGTTCCTAGGTTCAATGAACAGCTTGATACATCTTGACCTCTCCTACATCCCCTTCTCCGGTACACTGCCACCCCTGCTTAGCAACCTTACCAACTTGGAATATCTCGACCTCTCCTTCACATCATTTTCTGGTACACTTCCTCCTCAGCTGGGCAACCTTTCAAATTTACGGTATCTTGATGTTAGTGAGATGCAGAATGTAGTGTATTCGACTGACCTCTCATGGTTAAGTCGTCTGCATTTGTTAGAGTATATTGACATGAGCAATACTATTCTCAGCAAAATAACGAATTTGCCTGCCGTGCTCAACAAGATCCCAACTCTAAAGCATGTCCTCCTTTTGAATTGTTCAATTCCAAGTGCAAACCAATCCATCACACACCTAAACCTTACCCAGCTTGAGGAGCTTGATCTCTCTCTCAACTACTTTGGCCATCCAATTTCATCATGCTGGTTTTGGAAAGTAACAAGCATCAAGTCGCTCCGCCTAGATGAAACCTATCTCCATGGTCCCTTCCCTGACGAGCTAGGCGAAATGGTGTCGCTCCAACACCTAGATTTTTGTTTCAATGGAAATGCAGCCACAATGACTGTGGACTTGAACAACTTATGTGACCTGGAAAGCATATACCTTGACAAGAGTCTCTCATCCGGGAACATAACAGATTTGATGGATAAGTTACAGTGTTCCAGCAAATTGTATAGCTTGAGTTCTATAAGCAATAATATGATAGGAATGCTTCCAAGTAGTATAGAGCACTTCACCAGCTTAAATCACATTGATCTTACTAACAACAGTGTCAGTGGAGTCATGCCACGAGGATTTCAGAACATGGCTAATTTGGAGTACCTACATCTCAGTTCCAATCGACTCAGTGGCCAGATGCCCTTGTTACCGACAAGCCTCAAGATATTGCATGCCCAAATGAACTTCTTGTCAGGGCATCTCCCGTTGGAATTTAGAGCCCCAAATCTTGAAAACCTAATTATATCCTCCAATTACATTACTGGCCAAGTTCCTGGATCTATTTGTGAGTCAGAAAACATGAAACACTTGGATTTGTCAAACAATTTATTTGAGGGAGAAGTACCTCACTGTCGTCGTATGCGAAACTTACGTTTCCTGCTCTTAAGTAACAACAGCTTCTCTGGAAAGTTTCCCCAATGGATCCAAAGCTTCTCTTCACTGGTTTTCCTAGATCTTTCATGGAACATGTTCTATGGTTCGTTACCAAGGTGGATTGGAGACTTGGTGACCTTGCGTATTCTGCACCTGGGTCATAACATGTTCAATGGAGATATTCCAGTCAACATCACACATCTTACACAACTTCAATACCTGAATTTAGCAGACAATAATATATCAGGTTTAATTCCTCTATCTTTGTCACATTTTAATGAAATGACTCTAAAAGCTGTGGGTGATTCAATCTCGACCCTGGCATTTGATGAGTCATTTGATACATTTTCCCTCGGAATGAAGCATCAAATACTCAAGTATGGATCACATGGGGTCGTTGATATGGTTGGAATCGACTTATCGCTCAATCGCATAACCGGTGGAATTCCAGAGGAAATAACATCTCTCGATAGATTGTCTAATTTAAATTTATCATGGAATCGCTTGAGTGGGAAAATTCCGGAGAACATTGGGTCTATGAAATCAATAGAATCACTCGACCTCTCAAGGAACTACCTTTGTGGTGAAGTCCCATCAAGCTTGACAGATCTTACATATTTAAGCTACCTGGACCTATCGTACAACAATCTTACTGGAAAAGTTCCATCCGGACGCCAACTTGACACCTTGTACTTAGAGAATCCATCCATGTACAATGGAAACATTGGTCTTTGTGGCCCTCCTCTTCAAAGGAATTGTTCAAGCAATGGTTATGCACAAGGGCATGGTGATCACAAAGGACAAGAGAAGGATTCCAATTCAATGTTCTTTTACTATGGTCTTGCATCAGGTTTTGTTGTTGGTTATTGGGTTGTGTTTTGTGCTCTGCTATTCCACAAGTCATGGAGAGTCACTTATTTCTGCCTTGTGGACAAGGTATATGACAAGTTATATGTGTATGTGGTCATTACTTGGACCAGATGGATGAACACTACAAATTAA


Protein sequences

Name Description Sequence
Putative Cf2/Cf5 disease resistance protein homolog Putative Cf2/Cf5 disease resistance protein homolog [Oryza sativa Japonica Group].

MDGTSAKVVLFIGASFSFFLITHAQQQATRCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDKSLSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILHAQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEMTLKAVGDSISTLAFDESFDTFSLGMKHQILKYGSHGVVDMVGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLENPSMYNGNIGLCGPPLQRNCSSNGYAQGHGDHKGQEKDSNSMFFYYGLASGFVVGYWVVFCALLFHKSWRVTYFCLVDKVYDKLYVYVVITWTRWMNTTN

Putative Cf2/Cf5 disease resistance protein homolog Putative Cf2/Cf5 disease resistance protein homolog [Oryza sativa Japonica Group].

MDGTSAKVVLFIGASFSFFLITHAQQQATRCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDKSLSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILHAQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEMTLKAVGDSISTLAFDESFDTFSLGMKHQILKYGSHGVVDMVGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLENPSMYNGNIGLCGPPLQRNCSSNGYAQGHGDHKGQEKDSNSMFFYYGLASGFVVGYWVVFCALLFHKSWRVTYFCLVDKVYDKLYVYVVITWTRWMNTTN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF516
7-830 PTHR26393:SF516

KVVLFIGASFSFFLITHAQQQATRCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDKSLSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILHAQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEMTLKAVGDSISTLAFDESFDTFSLGMKHQILKYGSHGVVDMVGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLENPSMYNGNIGLCGPPLQRNCSSNGYAQGHGDHKGQEKDSNSMFFYYGLASGFVVGYWVVFCALLFHKSWRVTYFCLVDKVYDKLYVYVVITWTRWMN

HMMPanther: PTHR26393
7-830 PTHR26393,FAMILY NOT NAMED

KVVLFIGASFSFFLITHAQQQATRCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDKSLSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILHAQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEMTLKAVGDSISTLAFDESFDTFSLGMKHQILKYGSHGVVDMVGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLENPSMYNGNIGLCGPPLQRNCSSNGYAQGHGDHKGQEKDSNSMFFYYGLASGFVVGYWVVFCALLFHKSWRVTYFCLVDKVYDKLYVYVVITWTRWMN

HMMPanther: PTHR26393:SF516
7-830 PTHR26393:SF516

KVVLFIGASFSFFLITHAQQQATRCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDKSLSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILHAQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEMTLKAVGDSISTLAFDESFDTFSLGMKHQILKYGSHGVVDMVGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLENPSMYNGNIGLCGPPLQRNCSSNGYAQGHGDHKGQEKDSNSMFFYYGLASGFVVGYWVVFCALLFHKSWRVTYFCLVDKVYDKLYVYVVITWTRWMN

HMMPanther: PTHR26393
7-830 PTHR26393,FAMILY NOT NAMED

KVVLFIGASFSFFLITHAQQQATRCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDKSLSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILHAQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEMTLKAVGDSISTLAFDESFDTFSLGMKHQILKYGSHGVVDMVGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLENPSMYNGNIGLCGPPLQRNCSSNGYAQGHGDHKGQEKDSNSMFFYYGLASGFVVGYWVVFCALLFHKSWRVTYFCLVDKVYDKLYVYVVITWTRWMN

superfamily: SSF52058
29-340 SSF52058,LRR

TRCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDK

superfamily: SSF52058
29-340 SSF52058,LRR

TRCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDK

Gene3D: G3DSA:3.80.10.10
30-339 G3DSA:3.80.10.10

RCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLD

Gene3D: G3DSA:3.80.10.10
30-339 G3DSA:3.80.10.10

RCRPQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCSSKTGHVVKLDVNSFLTDDSPMVGQISPSLLSLNYLQYLDLSSNLLAGPNGSVPEFLGSMNSLIHLDLSYIPFSGTLPPLLSNLTNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQNVVYSTDLSWLSRLHLLEYIDMSNTILSKITNLPAVLNKIPTLKHVLLLNCSIPSANQSITHLNLTQLEELDLSLNYFGHPISSCWFWKVTSIKSLRLDETYLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLD

HMMPfam: PF08263
IPR013210
33-73 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCS

HMMPfam: PF08263
IPR013210
33-73 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PQERDALLSFKQGITNDSVGLLSSWRRGHGDCCSWAGITCS

ProfileScan: PS51450
IPR001611
107-128 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLQYLDLSSNLLAGPNGSVPEF

ProfileScan: PS51450
IPR001611
107-128 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLQYLDLSSNLLAGPNGSVPEF

HMMPfam: PF12799
157-193 LRR_4,Leucine Rich repeats (2 copies)

TNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQN

HMMPfam: PF12799
157-193 LRR_4,Leucine Rich repeats (2 copies)

TNLEYLDLSFTSFSGTLPPQLGNLSNLRYLDVSEMQN

ProfileScan: PS51450
IPR001611
208-229 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLEYIDMSNTILSKITNLPAVL

ProfileScan: PS51450
IPR001611
208-229 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLEYIDMSNTILSKITNLPAVL

ProfileScan: PS51450
IPR001611
259-281 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEELDLSLNYFGHPISSCWFWK

ProfileScan: PS51450
IPR001611
259-281 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEELDLSLNYFGHPISSCWFWK

superfamily: SSF52058
294-734 SSF52058,LRR

YLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDKSLSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILHAQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEMTLKAVGDSISTLAFDESFDTFSLGMKHQILKYGSHGVVDMVGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLEN

superfamily: SSF52058
294-734 SSF52058,LRR

YLHGPFPDELGEMVSLQHLDFCFNGNAATMTVDLNNLCDLESIYLDKSLSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILHAQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEMTLKAVGDSISTLAFDESFDTFSLGMKHQILKYGSHGVVDMVGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLEN

Gene3D: G3DSA:3.80.10.10
342-433 G3DSA:3.80.10.10

LSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILH

Gene3D: G3DSA:3.80.10.10
342-433 G3DSA:3.80.10.10

LSSGNITDLMDKLQCSSKLYSLSSISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRLSGQMPLLPTSLKILH

ProfileScan: PS51450
IPR001611
359-381 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLYSLSSISNNMIGMLPSSIEHF

ProfileScan: PS51450
IPR001611
359-381 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLYSLSSISNNMIGMLPSSIEHF

HMMPfam: PF13855
366-418 LRR_8,Leucine rich repeat

ISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRL

HMMPfam: PF13855
366-418 LRR_8,Leucine rich repeat

ISNNMIGMLPSSIEHFTSLNHIDLTNNSVSGVMPRGFQNMANLEYLHLSSNRL

ProfileScan: PS51450
IPR001611
383-404 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNHIDLTNNSVSGVMPRGFQN

ProfileScan: PS51450
IPR001611
383-404 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNHIDLTNNSVSGVMPRGFQN

ProfileScan: PS51450
IPR001611
407-429 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEYLHLSSNRLSGQMPLLPTSL

ProfileScan: PS51450
IPR001611
407-429 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEYLHLSSNRLSGQMPLLPTSL

Gene3D: G3DSA:3.80.10.10
434-595 G3DSA:3.80.10.10

AQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEM

Gene3D: G3DSA:3.80.10.10
434-595 G3DSA:3.80.10.10

AQMNFLSGHLPLEFRAPNLENLIISSNYITGQVPGSICESENMKHLDLSNNLFEGEVPHCRRMRNLRFLLLSNNSFSGKFPQWIQSFSSLVFLDLSWNMFYGSLPRWIGDLVTLRILHLGHNMFNGDIPVNITHLTQLQYLNLADNNISGLIPLSLSHFNEM

HMMPfam: PF13516
450-471 LRR_6,Leucine Rich repeat

PNLENLIISSNYITGQVPGSIC

HMMPfam: PF13516
450-471 LRR_6,Leucine Rich repeat

PNLENLIISSNYITGQVPGSIC

ProfileScan: PS51450
IPR001611
451-473 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLENLIISSNYITGQVPGSICES

ProfileScan: PS51450
IPR001611
451-473 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLENLIISSNYITGQVPGSICES

ProfileScan: PS51450
IPR001611
475-497 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NMKHLDLSNNLFEGEVPHCRRMR

ProfileScan: PS51450
IPR001611
475-497 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NMKHLDLSNNLFEGEVPHCRRMR

ProfileScan: PS51450
IPR001611
498-520 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRFLLLSNNSFSGKFPQWIQSF

ProfileScan: PS51450
IPR001611
498-520 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRFLLLSNNSFSGKFPQWIQSF

ProfileScan: PS51450
IPR001611
546-569 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRILHLGHNMFNGDIPVNITHLT

ProfileScan: PS51450
IPR001611
546-569 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRILHLGHNMFNGDIPVNITHLT

ProfileScan: PS51450
IPR001611
570-591 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQYLNLADNNISGLIPLSLSH

HMMPfam: PF00560
IPR001611
570-591 LRR_1
Leucine-rich repeat

QLQYLNLADNNISGLIPLSLSH

ProfileScan: PS51450
IPR001611
570-591 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQYLNLADNNISGLIPLSLSH

HMMPfam: PF00560
IPR001611
570-591 LRR_1
Leucine-rich repeat

QLQYLNLADNNISGLIPLSLSH

Gene3D: G3DSA:3.80.10.10
636-733 G3DSA:3.80.10.10

VGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLE

Gene3D: G3DSA:3.80.10.10
636-733 G3DSA:3.80.10.10

VGIDLSLNRITGGIPEEITSLDRLSNLNLSWNRLSGKIPENIGSMKSIESLDLSRNYLCGEVPSSLTDLTYLSYLDLSYNNLTGKVPSGRQLDTLYLE

ProfileScan: PS51450
IPR001611
658-680 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLSNLNLSWNRLSGKIPENIGSM

ProfileScan: PS51450
IPR001611
658-680 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLSNLNLSWNRLSGKIPENIGSM

HMMPfam: PF00560
IPR001611
659-679 LRR_1
Leucine-rich repeat

LSNLNLSWNRLSGKIPENIGS

HMMPfam: PF00560
IPR001611
659-679 LRR_1
Leucine-rich repeat

LSNLNLSWNRLSGKIPENIGS

ProfileScan: PS51450
IPR001611
682-705 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIESLDLSRNYLCGEVPSSLTDLT

ProfileScan: PS51450
IPR001611
682-705 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIESLDLSRNYLCGEVPSSLTDLT

HMMPfam: PF00560
IPR001611
682-702 LRR_1
Leucine-rich repeat

SIESLDLSRNYLCGEVPSSLT

HMMPfam: PF00560
IPR001611
682-702 LRR_1
Leucine-rich repeat

SIESLDLSRNYLCGEVPSSLT

ProfileScan: PS51450
IPR001611
706-728 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLSYLDLSYNNLTGKVPSGRQLD

ProfileScan: PS51450
IPR001611
706-728 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLSYLDLSYNNLTGKVPSGRQLD

HMMPfam: PF00560
IPR001611
707-723 LRR_1
Leucine-rich repeat

LSYLDLSYNNLTGKVPS

HMMPfam: PF00560
IPR001611
707-723 LRR_1
Leucine-rich repeat

LSYLDLSYNNLTGKVPS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox