PRGDB00061791 (Putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18693402 (AC099402)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa

Comment?

Oryza sativa chromosome 10 clone OSJNBa0022D10, complete sequence.

DNA Sequence

ATGGCTGAGGCTGTGATTCTTTTAGCTGTCAAGAAGATTGGTGTTGCCCTGGGGAATGAGGCAATCAATCAGGCCACTTCATATTTCAAAAAATTTGTCACACAACTGACAGAGCTTCAAGGTAGCATGGGACGCATCAAGAGAGAGCTTAGGCTGATGCATGAGTTTCTTTCCCGAATGGATGTCCGCAATCGCAACAATCAGACATATGAAATCTGGGTGGAGGAGGTCAGAATGTTAGTCCATCGGATTGAGGACATCGTGGATGATTACTTGCATCTTGTTGGCCACAAACAAGACACTGGATGGGGTACCTATCTGAAGAAAGGATTCAAGAGACCAAATGTTCTGTTCTCTTTAAACAGGATAGCTTCATCGATCAAGGACGCTGAGGCCAATTTAGTGCACTTGTTCCAAGCCAAAGAACGATGGGTGTGGATGGCTGGTGGAAGGGCTACTGGCAGCAAAAGCTCAAGCTATATTATTGAGACGTCTCGACATCTAGCTAATATTTCACGCTCCCTCGATGAAGATCTTGTGGGGGTCGATGAAAACATAAGAAAACTACATGAGTGGCTAACAAGTGATGAGTTGCAACGTGAGGTGATAGCGCTGCATGGGATGGGGGGTCTTGGTAAAACGGCTTTGGCAGCCAATGTGTACAGGAATGAGAGAGAAAAGTTTGAATGCCATGCTTGGGTCTCCATCTCTCAAACTTATTCCATCAAGGATGTTCTAAAATGTTTGGTCACTGAATTAGATTTAAAAAAGAAAATTCAGGGTAACATTGGTGACATGGATACTGCAACTCTCCAAAATGAACTGAAGAAATTCCTGATGGATCAGAAGTATTTGATCGTATTGGATGATGTTTGGGTACCAGAAACTGTCAACGACTTGTTTAGCATATTTGTTTCAAATCTCAAGGGGAGCAGAGTTCTCGTGACAACACGCATTGATGGTGTAGCCCACCTCGCTTTCCCGGACAAGAGGATAACACTAGAGCCTCTATCAGAAAAAAAGTCATGGGAACTCTTTTGTAAGACGGCTTTTCCAAGAGATAAAAACCATGAGTGTCCCACAAAACTGACAGTACTAGCACAACAAATAGTTAGTAAATGTGAAGGCTTACCTCTTGCAATTGTCTCTGTCGGTAGGCTCCTCTTTGTGCGTGACAAGACCGAAGAGGAATTTAGACGCATACAAAACCAGCTTGATTGGGAACTAATCAACAACCCAAGCCTGGAACATGTTCGGAATATCCTTTACTTGAGCTACATCTACCTTCCAACACATTTGAAAAGTTGCTTCTTGTATTGTAGTATGTTTCCGGAGGACTATCTTATAACAAGAAAGAAGCTTATACGGTGGTGGGTAGCAGAAGGGTTCATAGAGGAGAGAGGTGGAAACACAATGGAGGAAGTGGCAGAAGAGTATCTCAAGGAATTGGTTCACAGGAATATGTTGCAGCTTATTGAAATGAATGGATTTGGCAGGATAAAATCATTCAGAATGCATGATATTGTACGTGAGTTGGCAATTGATTTGTGCCGCAAAGAGCACTTCGGTTGTTCATACAATTGTGAGAATAAACATGGTAAATTTCTTGAGGGGAAGGACGAACGCCGCGTGGTAATACATAAATTAGACAAGCATATTAATCAAGCCATTTTGAATGAATGTCATAGCCTCCGGTGTTTGATCACATTGGACGAAGCGACACCACCATCACCATGTCTGCTACATTTGGTAGCAGACAAATGTAGGTATATGTCAGTACTTGAGTTAACTGGACTACCCATTGAAAAAGTTCCTGATGCTATTGGTGATCTATTTAACCTTCGACATCTTGGCCTACGGGGTTCAAAGGTGAAGCACCTCCCAAATTCTATAGAGAAGCTCTCTAACTTGCTGACGCTAGATCTCAACGAAACGGAAATACAAGAAGTGCCAAATGGGATTGTTAAGCTAAAGAAGCTTAGGCATTTGTTTGTTGAGAAAATGAATGAATTATATGGGAGAGAATTCCGGCCTCGCACTGGTGTGCGCATCCATAAAGGCCTAGAGAAGCTGAATGAGTTACAGACGCTTCAAGGACTAGAAGTTCAAGACGAAGTGTCCTTGAGGCGCTTAGGGGAGCTGAGACAGATGAGAAGCATCCGGATATGGGGTGTCAAGGAAAGCTACTGTGAAAGCCTCTGCGAGTCCCTGCAGCAGATGGAGTTTTTATCCTTCTTAAGTGTCAATGCAAGTGGCAAGGAGGAAGTCCTCAAATTGGATGGTCTAAACCCGCTGCCTCCAAACCTTCGAAAGCTTAACTTGCGTGGGATACTGGCAGAAGCAGGCATGTTGTTGGGTTCACCTGCAGCAGGAGATCAAAATAACCACTCGTTGTATTCAGTGCATCTATCGTGGTCTCAGCTGATAGAGGACCCACTGCCATCCCTCTCTAGGTGGTCAAGTCTGACGGACCTAATGTTGACAAGAGCATATGTTGGGGAGCAGTTTGTCTTCCACCAAGGGTGGTTTCCCAACCTCAAGGAACTCGTTTTAAGGGACATGCCTGATCTGAAGCGCCTGGAAATACACGATGGTGCCATGACAAGCCTGCAAGATCTAACTCTTGTTAACCTCAGTGGCTTGACAGAGGTTCCATCTGGCATCGAGTTACTTTCCACCCTCAAAAACCTGGGCTTTTGGGAGATCACCCAAGACTTCCTTGCAGCTTTGCGCCAATGCCATAGAATTCACCATATGCAGTGGTGGTACAGTGTACGGGGGGAGACAGATGGAGCTCTCTGA


Protein sequences

Name Description Sequence
Putative disease resistance protein Putative disease resistance protein [Oryza sativa].

MAEAVILLAVKKIGVALGNEAINQATSYFKKFVTQLTELQGSMGRIKRELRLMHEFLSRMDVRNRNNQTYEIWVEEVRMLVHRIEDIVDDYLHLVGHKQDTGWGTYLKKGFKRPNVLFSLNRIASSIKDAEANLVHLFQAKERWVWMAGGRATGSKSSSYIIETSRHLANISRSLDEDLVGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINNPSLEHVRNILYLSYIYLPTHLKSCFLYCSMFPEDYLITRKKLIRWWVAEGFIEERGGNTMEEVAEEYLKELVHRNMLQLIEMNGFGRIKSFRMHDIVRELAIDLCRKEHFGCSYNCENKHGKFLEGKDERRVVIHKLDKHINQAILNECHSLRCLITLDEATPPSPCLLHLVADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQMEFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELLSTLKNLGFWEITQDFLAALRQCHRIHHMQWWYSVRGETDGAL

Putative disease resistance protein Putative disease resistance protein [Oryza sativa].

MAEAVILLAVKKIGVALGNEAINQATSYFKKFVTQLTELQGSMGRIKRELRLMHEFLSRMDVRNRNNQTYEIWVEEVRMLVHRIEDIVDDYLHLVGHKQDTGWGTYLKKGFKRPNVLFSLNRIASSIKDAEANLVHLFQAKERWVWMAGGRATGSKSSSYIIETSRHLANISRSLDEDLVGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINNPSLEHVRNILYLSYIYLPTHLKSCFLYCSMFPEDYLITRKKLIRWWVAEGFIEERGGNTMEEVAEEYLKELVHRNMLQLIEMNGFGRIKSFRMHDIVRELAIDLCRKEHFGCSYNCENKHGKFLEGKDERRVVIHKLDKHINQAILNECHSLRCLITLDEATPPSPCLLHLVADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQMEFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELLSTLKNLGFWEITQDFLAALRQCHRIHHMQWWYSVRGETDGAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF207
11-891 OS11G0560000 PROTEIN,OS11G0560000 PROTEIN

KKIGVALGNEAINQATSYFKKFVTQLTELQGSMGRIKRELRLMHEFLSRMDVRNRNNQTYEIWVEEVRMLVHRIEDIVDDYLHLVGHKQDTGWGTYLKKGFKRPNVLFSLNRIASSIKDAEANLVHLFQAKERWVWMAGGRATGSKSSSYIIETSRHLANISRSLDEDLVGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINNPSLEHVRNILYLSYIYLPTHLKSCFLYCSMFPEDYLITRKKLIRWWVAEGFIEERGGNTMEEVAEEYLKELVHRNMLQLIEMNGFGRIKSFRMHDIVRELAIDLCRKEHFGCSYNCENKHGKFLEGKDERRVVIHKLDKHINQAILNECHSLRCLITLDEATPPSPCLLHLVADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQMEFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELL

HMMPanther: PTHR23155
11-891 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KKIGVALGNEAINQATSYFKKFVTQLTELQGSMGRIKRELRLMHEFLSRMDVRNRNNQTYEIWVEEVRMLVHRIEDIVDDYLHLVGHKQDTGWGTYLKKGFKRPNVLFSLNRIASSIKDAEANLVHLFQAKERWVWMAGGRATGSKSSSYIIETSRHLANISRSLDEDLVGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINNPSLEHVRNILYLSYIYLPTHLKSCFLYCSMFPEDYLITRKKLIRWWVAEGFIEERGGNTMEEVAEEYLKELVHRNMLQLIEMNGFGRIKSFRMHDIVRELAIDLCRKEHFGCSYNCENKHGKFLEGKDERRVVIHKLDKHINQAILNECHSLRCLITLDEATPPSPCLLHLVADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQMEFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELL

HMMPanther: PTHR23155:SF207
11-891 OS11G0560000 PROTEIN,OS11G0560000 PROTEIN

KKIGVALGNEAINQATSYFKKFVTQLTELQGSMGRIKRELRLMHEFLSRMDVRNRNNQTYEIWVEEVRMLVHRIEDIVDDYLHLVGHKQDTGWGTYLKKGFKRPNVLFSLNRIASSIKDAEANLVHLFQAKERWVWMAGGRATGSKSSSYIIETSRHLANISRSLDEDLVGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINNPSLEHVRNILYLSYIYLPTHLKSCFLYCSMFPEDYLITRKKLIRWWVAEGFIEERGGNTMEEVAEEYLKELVHRNMLQLIEMNGFGRIKSFRMHDIVRELAIDLCRKEHFGCSYNCENKHGKFLEGKDERRVVIHKLDKHINQAILNECHSLRCLITLDEATPPSPCLLHLVADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQMEFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELL

HMMPanther: PTHR23155
11-891 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KKIGVALGNEAINQATSYFKKFVTQLTELQGSMGRIKRELRLMHEFLSRMDVRNRNNQTYEIWVEEVRMLVHRIEDIVDDYLHLVGHKQDTGWGTYLKKGFKRPNVLFSLNRIASSIKDAEANLVHLFQAKERWVWMAGGRATGSKSSSYIIETSRHLANISRSLDEDLVGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINNPSLEHVRNILYLSYIYLPTHLKSCFLYCSMFPEDYLITRKKLIRWWVAEGFIEERGGNTMEEVAEEYLKELVHRNMLQLIEMNGFGRIKSFRMHDIVRELAIDLCRKEHFGCSYNCENKHGKFLEGKDERRVVIHKLDKHINQAILNECHSLRCLITLDEATPPSPCLLHLVADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQMEFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELL

superfamily: SSF52540
160-412 P-loop containing nucleoside triphosphate hydrolases

YIIETSRHLANISRSLDEDLVGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINN

superfamily: SSF52540
160-412 P-loop containing nucleoside triphosphate hydrolases

YIIETSRHLANISRSLDEDLVGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINN

Gene3D: G3DSA:3.40.50.300
180-317 no description

VGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTT

Gene3D: G3DSA:3.40.50.300
180-317 no description

VGVDENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTT

HMMPfam: PF00931
IPR002182
183-466 NB-ARC,NBS
NB-ARC

DENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINNPSLEHVRNILYLSYIYLPTHLKSCFLYCSMFPEDYLITRKKLIRWWVAEGFIEE

HMMPfam: PF00931
IPR002182
183-466 NB-ARC,NBS
NB-ARC

DENIRKLHEWLTSDELQREVIALHGMGGLGKTALAANVYRNEREKFECHAWVSISQTYSIKDVLKCLVTELDLKKKIQGNIGDMDTATLQNELKKFLMDQKYLIVLDDVWVPETVNDLFSIFVSNLKGSRVLVTTRIDGVAHLAFPDKRITLEPLSEKKSWELFCKTAFPRDKNHECPTKLTVLAQQIVSKCEGLPLAIVSVGRLLFVRDKTEEEFRRIQNQLDWELINNPSLEHVRNILYLSYIYLPTHLKSCFLYCSMFPEDYLITRKKLIRWWVAEGFIEE

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

VIALHGMGGLGKTALA

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

VIALHGMGGLGKTALA

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

FLMDQKYLIVLDDVW

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

FLMDQKYLIVLDDVW

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CEGLPLAIVSVGRLL

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CEGLPLAIVSVGRLL

superfamily: SSF52058
504-918 L domain-like,LRR

RMHDIVRELAIDLCRKEHFGCSYNCENKHGKFLEGKDERRVVIHKLDKHINQAILNECHSLRCLITLDEATPPSPCLLHLVADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQMEFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELLSTLKNLGFWEITQDFLAALRQCHRIHH

superfamily: SSF52058
504-918 L domain-like,LRR

RMHDIVRELAIDLCRKEHFGCSYNCENKHGKFLEGKDERRVVIHKLDKHINQAILNECHSLRCLITLDEATPPSPCLLHLVADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQMEFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELLSTLKNLGFWEITQDFLAALRQCHRIHH

Gene3D: G3DSA:3.80.10.10
585-740 no description

ADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQM

Gene3D: G3DSA:3.80.10.10
585-740 no description

ADKCRYMSVLELTGLPIEKVPDAIGDLFNLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEKMNELYGREFRPRTGVRIHKGLEKLNELQTLQGLEVQDEVSLRRLGELRQMRSIRIWGVKESYCESLCESLQQM

HMMPfam: PF13855
613-667 LRR_8,Leucine rich repeat

NLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEK

HMMPfam: PF13855
613-667 LRR_8,Leucine rich repeat

NLRHLGLRGSKVKHLPNSIEKLSNLLTLDLNETEIQEVPNGIVKLKKLRHLFVEK

FPrintScan: PR00364
IPR000767
632-648 DISEASERSIST
Disease resistance protein

EKLSNLLTLDLNETEIQ

FPrintScan: PR00364
IPR000767
632-648 DISEASERSIST
Disease resistance protein

EKLSNLLTLDLNETEIQ

Gene3D: G3DSA:3.80.10.10
741-897 no description

EFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELLSTLKNL

Gene3D: G3DSA:3.80.10.10
741-897 no description

EFLSFLSVNASGKEEVLKLDGLNPLPPNLRKLNLRGILAEAGMLLGSPAAGDQNNHSLYSVHLSWSQLIEDPLPSLSRWSSLTDLMLTRAYVGEQFVFHQGWFPNLKELVLRDMPDLKRLEIHDGAMTSLQDLTLVNLSGLTEVPSGIELLSTLKNL

Seg: seg
762-775 seg

LNPLPPNLRKLNLR

Seg: seg
762-775 seg

LNPLPPNLRKLNLR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox