PRGDB00061794 (putative NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 222446471 (AB379819)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group NBSt1 mRNA for putative NBS-LRR disease resistance protein, complete cds.

DNA Sequence

ATGGGCACAGTTTTGGATGCTCTCGCTTGGAAATTCTTGGAAAAGCTGGGTCAGCTTATTGAGGATGAGGTTATCATGACATTAAGTGTGAAAAGGGGTATTGAGAGCCTGAAGAAAAATCTGGAATTCTTCAACGCTGTTCGTGAGGATGCTGAGGCTCTGGCCATGGAGGATCCAGGGATAGATTCATGGTGGAAGAACATGAGAAATGTTATGTTTGATGTCGATGACATCGTGGATCTTTTCATGGTTCATTCACAGAAGTTTTTGCTGCCACCAAGGCCGGTATGTTGCAATCAGCCCTTGTTCTCTAGCTTTGCAAAGTTTTCATTTGATCACAGGATTGCCAAAAGAATCGATAATATAAATGAAAAGTTTGAAGAAATTAAAATGAACAAAGAGATGTTTGGCTTCGAGAGAACCAACCGGCAACAAGTCCAGATAACAATTGTTGACAGAAGTCAGACATCTCCTGTAGATGAACTTGAGGTTGTTGGAGAAGATATCAGAAGGGCTGTTGATGACATGGTCAAAATGATTGTTAGTAACTCCAATGACAACAGGTCAACTGTTTTTGGGATCCAGGGGATGGGAGGCATCGGTAAGACAACATTAGCTCAAAAGATATACAATGAACAGAGGATAAGGGAGAAATTCCAAGTTCATATATGGTTGTGTATTTCTCAGAATTACACAGAGACCAGTTTGTTAAAACAGGCAATAAGAATGGCTGGAGGAATTTGTGATCAGCTGGAGACTAAGACTGAGCTTCTACCGCTTCTAGTGGACACTATTAGAGGGAAGAGTGTTTTTCTTGTGCTGGATGATGTTTGGAAATCTGATGTATGGATTGATCTTCTTCGATCGCCTTCCGAGAGAGGCTTGAATTCTCGTATCCCTGTGACCTCAAGAAACCTGGATGTTTTGGTCGAAATGCATGCAACTTATACCCACAGGGTAAACAAAATGAATGATTACGATGGCCTAGAACTGCTGATGAAGATGTCATTAGGGCCATACGAGCAAAGAAGAGAATTCAGTGGTGTTGGGTATCAAATTGTCAAAAAGTGTGATGGCCTTCCTCTTGCCATCAAAGTTGTTGCAGGTGTCCTATCTAGTAAGAAAACAAAGGCAGAATGGGAGAGCATCCGAGATAGCAAATGGTCTATTCATGGACTTCCCAAAGAACTAGGAGGTCCTCTGTACTTAAGCTACAGCAACTTACCTCCTGAACTTAAGCAATTCTTTCTCTGGTGTGCTTTGTTACCATCAAATTTTGGGATCCATCGTGATGCTGTCGCTTACTGGTGGGTCGCTGAAGGCTTTGTGACGAAAATGCATGGGTACTCAATACATGAAGCCGCAGAAGAATACTACCATGAGCTAATTAGAATGAATCTTCTGCAGCCAAAACCAGAGTTTGTTGACAAATGGATGTCAACGATGCATGATCTTTTGAGGTCACTTGGACAATTTTTGACAAAGGATCATTCCTTATTCATGAATATGGAAAATAGCAAAGCCTTACTGAATCTACGTCACTTAGTAATAAGCAATGATGTAAAAGAAATACCTGCTATAGAAGAGCTGAAGTGCTTGAGGAGCCTCCTAATTTTTAATAACAAGAACTTTAAGACAATTAATAAGGACATTTTCAGAGAGCTCAAGCATATTCGTGTCTTAGTTCTTAGTGGAACAAGCATCCAAGTCATACCGGAGTCGGTGGGAAACTTGTTGCTACTGAGGTTGCTAGATCTAAGCTATACAAAAATAAAAAAACTCCCTGAATCCATAGGAAATCTTACCAGCCTTGAATACCTTTCTTTGCACTGTTGCAGACATTTGGATAGCCTGCCAGCTAGTTTGATGAGACTGTCCAACATAAGTTTCCTTGAGCTAGAACAAACTGGAATCGACCATGTTCCAAAAGGGATCGCGAAGTTTCAGAAACTCTACAACCTTAAAGGAGTTTTCGAGAGTGCATCTGGATTCAGGCTAGATGAACTGCAATGTCTCCCCAACATCCAACGTCTCCGGATTGTAAAGCTAGAAAAAGCAACGCCAGGGGGTGCATTTGTACTCAGGAACAGTCTTCGTCTTCGAGAACTGTGGTTTCGCTGCACAATGGGAGCTAATACTCATGATATTACCCACTACCAGATGAACGAGATTGAGAGAATTCAACAAGTCTATGAGATGCTAAGTCCATCATCAAGCCTAATTTATTTATTTTTTGAGGGGTTTCCTGGTGTAAGGTTCCCAGATTGGTTGTGCTCAGAACCAGAGTATAAGATGCCAAATTTGGGACATATGTACCTCAACGAGTGCATTTCATGCTCTGAGCTTCCACCAGCAGGTCAGATGCCAGAACTACTAATTCTTCAGATCAGATGTGCAGATGCAGTAGTGAATATTGGTTCAGAGCTCCTAGGAAAAGGCGTCAGCAGTGCCACGCATATAACTATTTTCCCAAAGCTCAAATTGCTTCACATCATTGATATGAGCAATTTGGAAAGTTGGTCTCTTAACACAGGGAATTTGCGTGGTAGATCTGAACAGCTCGTTCTGATGCCTTGCCTTAAGCGTCTGTTTCTTAATGGCTGCCCAAAACTAAGGGCTCTCCCTGAAGACTTGCATAGGATTGCTAACTTAAGAAGAATCCACATTGAAGGTGCTCACACGCTGCATGAAATTGACAACCTTCCTTCAGTGTTATGGCTCAAGGTCAAGAATAACAGGTGTTTGAGGAGAATTTCCAATCTCTGTATTCTGCAGGACTTGTTTGCACAGGACTGTCCAGCGCTGGATCAGGCAGAGAATCTAATCTCACTAAAGAGACTCCACATGGTTGATTGCCAGAATGCAAAGCAATTCAGAATGTGCCTCCTAGAAGACCAACAACTTGCAGTCGATGTTGTTACAGTTGGTGCAGATGGCAGGGATATCTTTCCAGATGAAACTCTCTATAATTAG


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein putative NBS-LRR disease resistance protein [Oryza sativa Japonica Group].

MGTVLDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVREDAEALAMEDPGIDSWWKNMRNVMFDVDDIVDLFMVHSQKFLLPPRPVCCNQPLFSSFAKFSFDHRIAKRIDNINEKFEEIKMNKEMFGFERTNRQQVQITIVDRSQTSPVDELEVVGEDIRRAVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMHGYSIHEAAEEYYHELIRMNLLQPKPEFVDKWMSTMHDLLRSLGQFLTKDHSLFMNMENSKALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRLHMVDCQNAKQFRMCLLEDQQLAVDVVTVGADGRDIFPDETLYN

putative NBS-LRR disease resistance protein putative NBS-LRR disease resistance protein [Oryza sativa Japonica Group].

MGTVLDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVREDAEALAMEDPGIDSWWKNMRNVMFDVDDIVDLFMVHSQKFLLPPRPVCCNQPLFSSFAKFSFDHRIAKRIDNINEKFEEIKMNKEMFGFERTNRQQVQITIVDRSQTSPVDELEVVGEDIRRAVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMHGYSIHEAAEEYYHELIRMNLLQPKPEFVDKWMSTMHDLLRSLGQFLTKDHSLFMNMENSKALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRLHMVDCQNAKQFRMCLLEDQQLAVDVVTVGADGRDIFPDETLYN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF173
5-947 PTHR23155:SF173,OS08G0332600 PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVREDAEALAMEDPGIDSWWKNMRNVMFDVDDIVDLFMVHSQKFLLPPRPVCCNQPLFSSFAKFSFDHRIAKRIDNINEKFEEIKMNKEMFGFERTNRQQVQITIVDRSQTSPVDELEVVGEDIRRAVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMHGYSIHEAAEEYYHELIRMNLLQPKPEFVDKWMSTMHDLLRSLGQFLTKDHSLFMNMENSKALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRL

HMMPanther: PTHR23155
5-947 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVREDAEALAMEDPGIDSWWKNMRNVMFDVDDIVDLFMVHSQKFLLPPRPVCCNQPLFSSFAKFSFDHRIAKRIDNINEKFEEIKMNKEMFGFERTNRQQVQITIVDRSQTSPVDELEVVGEDIRRAVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMHGYSIHEAAEEYYHELIRMNLLQPKPEFVDKWMSTMHDLLRSLGQFLTKDHSLFMNMENSKALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRL

HMMPanther: PTHR23155:SF173
5-947 PTHR23155:SF173,OS08G0332600 PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVREDAEALAMEDPGIDSWWKNMRNVMFDVDDIVDLFMVHSQKFLLPPRPVCCNQPLFSSFAKFSFDHRIAKRIDNINEKFEEIKMNKEMFGFERTNRQQVQITIVDRSQTSPVDELEVVGEDIRRAVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMHGYSIHEAAEEYYHELIRMNLLQPKPEFVDKWMSTMHDLLRSLGQFLTKDHSLFMNMENSKALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRL

HMMPanther: PTHR23155
5-947 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVREDAEALAMEDPGIDSWWKNMRNVMFDVDDIVDLFMVHSQKFLLPPRPVCCNQPLFSSFAKFSFDHRIAKRIDNINEKFEEIKMNKEMFGFERTNRQQVQITIVDRSQTSPVDELEVVGEDIRRAVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMHGYSIHEAAEEYYHELIRMNLLQPKPEFVDKWMSTMHDLLRSLGQFLTKDHSLFMNMENSKALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRL

Gene3D: G3DSA:3.40.50.300
171-279 G3DSA:3.40.50.300

RAVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWK

Gene3D: G3DSA:3.40.50.300
171-279 G3DSA:3.40.50.300

RAVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWK

superfamily: SSF52540
172-386 SSF52540

AVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDS

superfamily: SSF52540
172-386 SSF52540

AVDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDS

HMMPfam: PF00931
IPR002182
173-447 NB-ARC,NBS
NB-ARC

VDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMH

HMMPfam: PF00931
IPR002182
173-447 NB-ARC,NBS
NB-ARC

VDDMVKMIVSNSNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRIPVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMH

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

VFGIQGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

VFGIQGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
264-278 DISEASERSIST
Disease resistance protein

TIRGKSVFLVLDDVW

FPrintScan: PR00364
IPR000767
264-278 DISEASERSIST
Disease resistance protein

TIRGKSVFLVLDDVW

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CDGLPLAIKVVAGVL

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CDGLPLAIKVVAGVL

Gene3D: G3DSA:3.80.10.10
507-706 G3DSA:3.80.10.10

KALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFR

superfamily: SSF52058
507-880 SSF52058,LRR

KALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHR

Gene3D: G3DSA:3.80.10.10
507-706 G3DSA:3.80.10.10

KALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFR

superfamily: SSF52058
507-880 SSF52058,LRR

KALLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHR

HMMPfam: PF12799
581-619 LRR_4,Leucine Rich repeats (2 copies)

LRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLP

HMMPfam: PF12799
581-619 LRR_4,Leucine Rich repeats (2 copies)

LRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLP

FPrintScan: PR00364
IPR000767
599-615 DISEASERSIST
Disease resistance protein

GNLTSLEYLSLHCCRHL

FPrintScan: PR00364
IPR000767
599-615 DISEASERSIST
Disease resistance protein

GNLTSLEYLSLHCCRHL

Gene3D: G3DSA:3.80.10.10
767-786 G3DSA:3.80.10.10

NLGHMYLNECISCSELPPAG

Gene3D: G3DSA:3.80.10.10
767-786 G3DSA:3.80.10.10

NLGHMYLNECISCSELPPAG

Gene3D: G3DSA:3.80.10.10
831-952 G3DSA:3.80.10.10

IIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRLHMVDC

Gene3D: G3DSA:3.80.10.10
831-952 G3DSA:3.80.10.10

IIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRLHMVDC


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox