PRGDB00061796 (NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 222446465 (AB379817)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Pit gene for NBS-LRR disease resistance protein, complete cds, note: NBSt2.

DNA Sequence

ATGGGCACAGTTTTGGATGCTCTCGCTTGGAAATTCTTGGAAAAGCTGGGTCAACTTATTGAGGATGAGGTTATCATGACATTAAGTGTGAAAAGGGGTATTGAGAGCCTGAAGAAAAATCTGGAATTCTTCAACGCTGTTCATGAGGATGCTGAGGCTCTGGCCATGGAGGATCCAGGGATAGATTCATGGTGGAAGAACATGAGAGATGTTATGTTTGATGTCGATGACATCGTAGATCTTTTCATGGTTCATTCACAGAAGCTCTTGCTGCCACCAAGGCCGGTATGTTGCAATCAGCCCTTGTTCTCTAGCTTTGCAAAGTTTTCATTTGATCACATGATTGCCAAAAGAATTGATAATATAAATGAAAAGTTTGAAGAAATTAAAATGAACAAAGAGATGTTTGGCTTGGAGAGAACCAACGGGCAACAAATCCAGATAACAATTGTTGACAGAAGTCAGACATCTCCTGTAGATGAACTTGAGGTGGTTGGAGAAGATATCAGAAGGGCTATTGATGACATCGTCAAAATGATTGTTAGTAGTAACTACAATGAAAGCAGGTCAACTGTTTTTGGGATCCAGGGGATGGGAGGCATCGGTAAGACAACATTAGCTCAAAAGATATACAATGAACAGAGGATAAGGGAGAAATTCCAAGTTCATATATGGTTGTGCATTTCTCAGAATTACACAGAGACCAGTTTGTTAAAACAGGCAATCAGAATGGCTGGAGGAATTTGTGATCAGCTGGAGACTAAGACTGAGCTTCTACCGCTTCTAGTGGACACTATTAGAGGGAAGAGTGTTTTTCTTGTGCTGGATGATGTTTGGAAATCTGATGTATGGATTGATCTTCTTCGTTTGCCTTTCTTGAGAGGTTTGAATTCTCATATCCTTGTGACCTCAAGAAACCTGGATGTTTTGGTTGAAATGCATGCAACTTATACCCACAAGGTAAACAAAATGAATGATTGCGATGGCCTAGAACTGCTGATGAAGATGTCATTAGGGCCATACGAGCAAAGCAGAGAATTCAGTGGTGTTGGATATCAAATTGTCAAAAAGTGTGATGGCCTTCCTCTTGCCATCAAAGTTGTTGCAGGTGTTCTATCTACTAAAAGAACAAGGGCAGAATGGGAGAGTATCCGAGATAGCAAGTGGTCCATTCATGGACTTCCCAGAGAACTAGGAGGCCCTCTGTACTTAAGCTACAGCAACTTACCCCCTGAACTTAAACAATGCTTTCTCTGGTGTGCTTTGTTGCCGTCAAATTTTGTGATACGTCGTGATGCTGTCGCTTACTGGTGGGTTGCTGAAGGTTTCGTGACGGAAGTGCATGGGTACTCAATACATGAGGTTGCTGAAGAGTACTACCATGAGCTAATCAGAAGGAATCTTCTGCAGCCACGACCAGAGTTTGTAGACAAAGGCGAGTCAACAATGCATGATCTATTGAGGTCACTTGGTCAATTTTTGACAAAGGATCACTCCATATTCATGAACATGGAATATAGCAAAGCCTTACCAAATCTACGCCACTTATGTATCAGCAATGATGTAGAAGAAATACCTGCTATAGAAAAGCAAAAGTGCTTGAGGAGCCTCCTAGTTTTTGATAACAAAAACTTCATGAAAATTAATAAGGACATTTTCAGAGAACTCAAGCATATCCGTGTCTTAGTTCTCAGTGGAACAAGCATCCAAATCATACCAGAGTCAGTGGGAAACTTCTTGTTACTGAGGCTTCTAGATCTAAGCTATACAAAAATTCAGAAACTCCCAGAATCCATAGGAAAACTTACCAGCCTTGAATACCTTTCTTTGCATGGTTGCATACATTTGGATAGCCTGCCAGATAGTTTAATGAGACTGTCGAACATAAGTTTCCTAGAGCTAGAACAGACTGCAATCGACCATGTTCCAAAAGGAGTTGCAAAGTTGCAGCAACTCTACAACCTTAGAGGAGTTTTTGACAGTGGAACTGGATTCAGACTAGATGAACTCCAATGTCTCTCCAATATCCAACGTCTCCGGATTGTGAAGCTAGAAAAAGCAGCACCAGGGGGTTCATTTGTACTCAAGAACTGTCTTCATCTTCGAGAATTGTGGCTCGGTTGCACAATCGGAGGTCATGATAAAACTTATTATCAGACCAACGAGATTGAGAGAATTCAGCAAGTCTACGAACTGCTAATTCCATCGCCAAGCTTACTGTATATATTTCTTGTCGGGTTCCCTGGTGTAAGGTTCCCAGATTGGTTGTGCTCAGAACCAGAGCGTAAGATGCCAAATTTGGGTCATATGCACCTCAACGACTGCACTTCATGTTCAGTGCTTCCACCAGCAGGCCAGATGCCAGAACTGCTAGTTTTTAAGATTAAAGGCGCAGATGCAATAGTGAATATGGGTGCAGAGCTGCTAGGGAAAGGCGTCAATAGCGCAAAGCATATAACTATTTTTCCAAAACTCGAATTGCTTCTCATCACTAACATGAGCAATTTGGAAAGTTGGTCTCTCAACACATGGAATTTGTGTGGCAAATCTGAACAGCTTGTTCTGATGCCTTGCCTTAAGCGTTTGTTTCTTAACGACTGCCCAAAACTAAGGGCTCTCCCTGAAGACTTGCATAGGATTGCTAACTTAAGAAGAATCCATATCGAAGGTGCTCACACGCTGCAAGAAGTTGACAACCTTCCTTCAGTGTTATGGCTCAAGGTCAAGAACAACAGGTGTTTGAGGAGAATTTCCAATCTCTGTAATCTAAAGGACTTGCTTGCGCAGGACTGTCCAGCGCTGTATCAGGCAGAGAATCTAATCTCACTAAAGAGACTCTACATGGTCGATTGCCACAACGCGAAGCAATTCAGGATGAGCCTCCTGGAAGACCAACAACTTGCCGTCCATGTTGTTACAGTTGGTGCAGATGGCAGGGATATCTTTCCAGATGAATCTCTCTATAATTAG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Oryza sativa Japonica Group].

MGTVLDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPGIDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRIDNINEKFEEIKMNKEMFGLERTNGQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGESTMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQTNEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCHNAKQFRMSLLEDQQLAVHVVTVGADGRDIFPDESLYN

NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Oryza sativa Japonica Group].

MGTVLDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPGIDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRIDNINEKFEEIKMNKEMFGLERTNGQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGESTMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQTNEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCHNAKQFRMSLLEDQQLAVHVVTVGADGRDIFPDESLYN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF173
5-946 PTHR23155:SF173,OS08G0332600 PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPGIDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRIDNINEKFEEIKMNKEMFGLERTNGQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGESTMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQTNEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRL

HMMPanther: PTHR23155
5-946 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPGIDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRIDNINEKFEEIKMNKEMFGLERTNGQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGESTMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQTNEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRL

HMMPanther: PTHR23155:SF173
5-946 PTHR23155:SF173,OS08G0332600 PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPGIDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRIDNINEKFEEIKMNKEMFGLERTNGQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGESTMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQTNEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRL

HMMPanther: PTHR23155
5-946 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPGIDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRIDNINEKFEEIKMNKEMFGLERTNGQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGESTMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQTNEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRL

HMMPfam: PF00931
IPR002182
172-448 NB-ARC,NBS
NB-ARC

AIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVH

superfamily: SSF52540
172-387 SSF52540

AIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDS

HMMPfam: PF00931
IPR002182
172-448 NB-ARC,NBS
NB-ARC

AIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWCALLPSNFVIRRDAVAYWWVAEGFVTEVH

superfamily: SSF52540
172-387 SSF52540

AIDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDGLPLAIKVVAGVLSTKRTRAEWESIRDS

Gene3D: G3DSA:3.40.50.300
173-309 G3DSA:3.40.50.300

IDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDV

Gene3D: G3DSA:3.40.50.300
173-309 G3DSA:3.40.50.300

IDDIVKMIVSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHILVTSRNLDV

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VFGIQGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VFGIQGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
265-279 DISEASERSIST
Disease resistance protein

TIRGKSVFLVLDDVW

FPrintScan: PR00364
IPR000767
265-279 DISEASERSIST
Disease resistance protein

TIRGKSVFLVLDDVW

FPrintScan: PR00364
IPR000767
358-372 DISEASERSIST
Disease resistance protein

CDGLPLAIKVVAGVL

FPrintScan: PR00364
IPR000767
358-372 DISEASERSIST
Disease resistance protein

CDGLPLAIKVVAGVL

superfamily: SSF52058
506-870 SSF52058,LRR

YSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQTNEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKL

superfamily: SSF52058
506-870 SSF52058,LRR

YSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQTNEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKL

Gene3D: G3DSA:3.80.10.10
512-711 G3DSA:3.80.10.10

NLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIG

Gene3D: G3DSA:3.80.10.10
512-711 G3DSA:3.80.10.10

NLRHLCISNDVEEIPAIEKQKCLRSLLVFDNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFDSGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIG

HMMPfam: PF12799
582-620 LRR_4,Leucine Rich repeats (2 copies)

LRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLP

HMMPfam: PF12799
582-620 LRR_4,Leucine Rich repeats (2 copies)

LRLLDLSYTKIQKLPESIGKLTSLEYLSLHGCIHLDSLP

FPrintScan: PR00364
IPR000767
600-616 DISEASERSIST
Disease resistance protein

GKLTSLEYLSLHGCIHL

FPrintScan: PR00364
IPR000767
600-616 DISEASERSIST
Disease resistance protein

GKLTSLEYLSLHGCIHL

Gene3D: G3DSA:3.80.10.10
750-776 G3DSA:3.80.10.10

VRFPDWLCSEPERKMPNLGHMHLNDCT

Gene3D: G3DSA:3.80.10.10
750-776 G3DSA:3.80.10.10

VRFPDWLCSEPERKMPNLGHMHLNDCT

Gene3D: G3DSA:3.80.10.10
777-954 G3DSA:3.80.10.10

SCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCHNA

Gene3D: G3DSA:3.80.10.10
777-954 G3DSA:3.80.10.10

SCSVLPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCHNA

superfamily: SSF52047
823-952 SSF52047,LRR

PKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCH

superfamily: SSF52047
823-952 SSF52047,LRR

PKLELLLITNMSNLESWSLNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNLPSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCH


List of References

Keiko Hayashi, Hitoshi Yoshida
Refunctionalization of the ancient rice blast disease resistance gene Pit by the recruitment of a retrotransposon as a promoter.
Plant J.: 2009, 57(3);413-25
PubMed:18808453 WorldCat.org DOI (I p)

Keiko Hayashi, Hitoshi Yoshida
Refunctionalization of the ancient rice blast disease resistance gene Pit by the recruitment of a retrotransposon as a promoter.
Plant J.: 2009, 57(3);413-25
PubMed:18808453 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox