PRGDB00061801 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 332189094 (CP002684)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1, complete sequence.

DNA Sequence

ATGAAGACTAATTTTGTTATTCTACTTCTTCTCCTCTGTGTTTTTGCGATCAGCCCTAGTCAACAAGAAGAGATCAATCAACATAATCCAGGGATATATCATCAAAAGCTGCTATACAAGGTCCAACAATGGAGAACATCTTTGAAAGAATCAAATTCTGTAGAACTCAAGCTATCTTTAGCAGCCATTGTGGCTGGAGTGTTATACTTCCTTGCTGCCTTAATCTCGAGCGCATGTGGAATCGGCAGTGGAGGTTTATTCATTCCAATCACGACTCTAGTTTCACGGCTAGACTTGAAAACAGGGAAGCGTTTCTTGGGCCAATACTTGATATGGGTGATATTATTGTTGGGGCAGCTCCATGAATGCAAAAGCTGCATTGAGAAAGAAAGAGTAGCTTTGTTGGATTTTAAGAAATATTGGATGTCCATTACGCAAGAATCGGACTTGGACTATGTTTTCCCTACTTGGAATAATGACACAAAGAGCGATTGTTGCCAGTGGGAGAGCATTATGTGCAATCCTACAAGTGGGCGGCTTATCAGGCTTCACGTTGGTGCTTCGAATTTAAAAGAGAATTCTCTACTAAATATTTCTTTACTGCATCCCTTTGAAGAGGTTCGAAGTCTAGAATTATCAGCTGGGCTCAATGGCTTCGTTGATAATGTTGAAGGTTATAAAAGCTTAAGGAAATTAAAAAATTTGGAGATTCTGGATCTCTCTTATAATAATAGATTCAACAACAACATACTTCCATTTATTAATGCTGCTACGTCACTTACAAGCCTTTCTCTTCAAAATAACTCCATGGAAGGCCCTTTCCCTTTTGAAGAAATAAAAGACTTGACAAACTTGAAACTATTGGATCTTAGTAGAAACATACTAAAAGGCCCCATGCAAGGGTTGACTCATCTGAAAAAGCTAAAAGCTTTGGATCTAAGTAACAATGTTTTTTCGAGCATAATGGAATTGCAAGTAGTTTGTGAAATGAAGAATTTGTGGGAGCTTGATCTTCGTGAAAATAAATTTGTAGGTCAGCTTCCTCTTTGTTTAGGTAGATTAAACAAGCTAAGGGTTCTTGATTTGTCATCCAACCAGCTAAATGGAAATCTACCATCTACTTTCAACAGACTCGAGTCCCTTGAATATCTATCATTATTAGATAACAACTTCACCGGCTTCTTCTCATTTGATCCACTCGCCAACCTCACAAAGCTTAAGATGCCTGCTACAATAGTGCATGAGTTGCAGTTCTTGGATTTTTCAGTGAATGATATTAGTGGACTGCTCCCTGATAATATCGGTTATGCGCTTCCGAATCTGTTACGAATGAACGGCTCAAGAAATGGGTTTCAAGGGCATTTACCATCTTCTATGGGTGAGATGGTAAACATTACATCCCTTGATCTATCTTATAATAACTTCTCCGGGAAGCTACCTAGACGCTTTGTCACTGGTTGTTTTTCACTAAAACACTTGAAGCTCTCCCACAACAATTTTAGTGGCCATTTTCTTCCAAGAGAAACAAGCTTTACTTCCCTGGAAGAGTTGAGAGTTGATAGCAACTCATTCACTGGGAAGATCGGAGTTGGTTTGCTTAGCTCCAACACTACGTTATCAGTTCTTGACATGTCCAACAATTTTCTAACGGGTGATATTCCAAGCTGGATGTCTAACTTATCTGGTTTAACTATCTTGTCGATATCAAACAATTTTTTAGAAGGTACGATACCACCATCTTTGCTAGCCATTGGCTTTCTTTCTCTCATCGACCTATCGGGAAACTTATTATCTGGATCCTTACCGTCACGTGTTGGTGGGGAGTTTGGGATAAAATTGTTCCTACACGACAACATGCTCACGGGGCCGATTCCAGACACGTTGTTGGAAAAGGTCCAAATACTTGATTTACGGTACAATCAACTTTCTGGGAGTATTCCACAATTTGTCAATACCGAGAGCATATATATTCTTTTAATGAAGGGAAACAACTTAACAGGATCTATGTCAAGGCAGCTCTGTGATTTGAGAAATATCAGACTTTTAGATCTTTCAGATAACAAGCTCAATGGCTTCATACCTTCATGTCTATATAATTTATCATTTGGACCAGAGGATACAAATTCATATGTAGGTACAGCCATAACGAAGATTACTCCGTTCAAGTTTTACGAATCCACATTTGTGGTAGAGGATTTTGTGGTAATATCCTCTAGTTTTCAAGAAATTGAAATCAAATTTTCAATGAAGCGAAGGTATGATTCTTATTTTGGAGCAACTGAATTCAACAATGACGTACTTGATTATATGTATGGAATGGACCTATCAAGCAATGAGTTAAGTGGGGTTATCCCAGCAGAGCTTGGAAGTCTCTCAAAGCTACGAGTCATGAATTTATCTTGCAACTTCTTGTCCAGTTCAATACCATCTAGCTTCTCCAATCTCAAGGATATTGAGAGCCTTGACCTTTCGCATAACATGTTACAAGGAAGTATTCCTCAACAACTAACCAACCTTTCTTCTCTTGTTGTCTTTGATGTGTCTTACAATAATTTATCCGGAATCATTCCCCAAGGAAGGCAGTTTAATACCTTTGACGAGAAAAGCTACTTGGGAAATCCTCTTCTTTGTGGACCACCGACCAATAGAAGTTGTGATGCTAAGAAGACCTCAGATGAATCAGAAAATGGAGGAGAAGAAGAAGATGATGAAGCTCCTGTTGATATGTTGGCCTTCTATTTTAGTAGTGCTTCGACTTATGTAACTACATTGATAGGCATTTTTATACTTATGTGCTTTGATTGTCCTTTGCGTCGAGCATGGCTCCGCATTGTCGATGCTTCCATCGCCTCAGTCAAAAGTATGTTGCCTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MKTNFVILLLLLCVFAISPSQQEEINQHNPGIYHQKLLYKVQQWRTSLKESNSVELKLSLAAIVAGVLYFLAALISSACGIGSGGLFIPITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAWLRIVDASIASVKSMLP

putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MKTNFVILLLLLCVFAISPSQQEEINQHNPGIYHQKLLYKVQQWRTSLKESNSVELKLSLAAIVAGVLYFLAALISSACGIGSGGLFIPITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAWLRIVDASIASVKSMLP

putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MKTNFVILLLLLCVFAISPSQQEEINQHNPGIYHQKLLYKVQQWRTSLKESNSVELKLSLAAIVAGVLYFLAALISSACGIGSGGLFIPITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAWLRIVDASIASVKSMLP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
90-941 PTHR24420,FAMILY NOT NAMED

ITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

HMMPanther: PTHR24420:SF914
90-941 PTHR24420:SF914

ITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

HMMPanther: PTHR24420
90-941 PTHR24420,FAMILY NOT NAMED

ITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

HMMPanther: PTHR24420:SF914
90-941 PTHR24420:SF914

ITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

HMMPanther: PTHR24420:SF914
90-941 PTHR24420:SF914

ITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

HMMPanther: PTHR24420
90-941 PTHR24420,FAMILY NOT NAMED

ITTLVSRLDLKTGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKMPATIVHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

superfamily: SSF52058
124-408 SSF52058,LRR

KSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKM

superfamily: SSF52058
124-408 SSF52058,LRR

KSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKM

superfamily: SSF52058
124-408 SSF52058,LRR

KSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKM

Gene3D: G3DSA:3.80.10.10
127-407 G3DSA:3.80.10.10

IEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLK

Gene3D: G3DSA:3.80.10.10
127-407 G3DSA:3.80.10.10

IEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLK

Gene3D: G3DSA:3.80.10.10
127-407 G3DSA:3.80.10.10

IEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLK

HMMPfam: PF08263
IPR013210
129-174 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCN

HMMPfam: PF08263
IPR013210
129-174 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCN

HMMPfam: PF08263
IPR013210
129-174 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCN

ProfileScan: PS51450
IPR001611
234-255 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILDLSYNNRFNNNILPFIN

ProfileScan: PS51450
IPR001611
234-255 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILDLSYNNRFNNNILPFIN

ProfileScan: PS51450
IPR001611
234-255 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILDLSYNNRFNNNILPFIN

ProfileScan: PS51450
IPR001611
259-280 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSLSLQNNSMEGPFPFEEIK

ProfileScan: PS51450
IPR001611
259-280 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSLSLQNNSMEGPFPFEEIK

ProfileScan: PS51450
IPR001611
259-280 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSLSLQNNSMEGPFPFEEIK

ProfileScan: PS51450
IPR001611
284-306 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKLLDLSRNILKGPMQGLTHLK

ProfileScan: PS51450
IPR001611
284-306 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKLLDLSRNILKGPMQGLTHLK

ProfileScan: PS51450
IPR001611
284-306 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKLLDLSRNILKGPMQGLTHLK

ProfileScan: PS51450
IPR001611
307-328 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKALDLSNNVFSSIMELQVVC

ProfileScan: PS51450
IPR001611
307-328 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKALDLSNNVFSSIMELQVVC

ProfileScan: PS51450
IPR001611
307-328 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKALDLSNNVFSSIMELQVVC

HMMPfam: PF00560
IPR001611
356-377 LRR_1
Leucine-rich repeat

KLRVLDLSSNQLNGNLPSTFNR

ProfileScan: PS51450
IPR001611
356-378 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVLDLSSNQLNGNLPSTFNRL

HMMPfam: PF00560
IPR001611
356-377 LRR_1
Leucine-rich repeat

KLRVLDLSSNQLNGNLPSTFNR

ProfileScan: PS51450
IPR001611
356-378 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVLDLSSNQLNGNLPSTFNRL

ProfileScan: PS51450
IPR001611
356-378 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVLDLSSNQLNGNLPSTFNRL

HMMPfam: PF00560
IPR001611
356-377 LRR_1
Leucine-rich repeat

KLRVLDLSSNQLNGNLPSTFNR

FPrintScan: PR00019
357-370 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLNGN

FPrintScan: PR00019
357-370 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLNGN

FPrintScan: PR00019
357-370 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLNGN

ProfileScan: PS51450
IPR001611
380-401 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLSLLDNNFTGFFSFDPLA

ProfileScan: PS51450
IPR001611
380-401 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLSLLDNNFTGFFSFDPLA

ProfileScan: PS51450
IPR001611
380-401 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLSLLDNNFTGFFSFDPLA

superfamily: SSF52058
414-701 SSF52058,LRR

HELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLS

superfamily: SSF52058
414-701 SSF52058,LRR

HELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLS

superfamily: SSF52058
414-701 SSF52058,LRR

HELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLS

ProfileScan: PS51450
IPR001611
415-436 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELQFLDFSVNDISGLLPDNIGY

ProfileScan: PS51450
IPR001611
415-436 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELQFLDFSVNDISGLLPDNIGY

ProfileScan: PS51450
IPR001611
415-436 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELQFLDFSVNDISGLLPDNIGY

Gene3D: G3DSA:3.80.10.10
415-606 G3DSA:3.80.10.10

ELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVG

Gene3D: G3DSA:3.80.10.10
415-606 G3DSA:3.80.10.10

ELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVG

Gene3D: G3DSA:3.80.10.10
415-606 G3DSA:3.80.10.10

ELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVG

HMMPfam: PF00560
IPR001611
464-483 LRR_1
Leucine-rich repeat

NITSLDLSYNNFSGKLPRRF

ProfileScan: PS51450
IPR001611
464-485 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NITSLDLSYNNFSGKLPRRFVT

HMMPfam: PF00560
IPR001611
464-483 LRR_1
Leucine-rich repeat

NITSLDLSYNNFSGKLPRRF

ProfileScan: PS51450
IPR001611
464-485 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NITSLDLSYNNFSGKLPRRFVT

ProfileScan: PS51450
IPR001611
464-485 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NITSLDLSYNNFSGKLPRRFVT

HMMPfam: PF00560
IPR001611
464-483 LRR_1
Leucine-rich repeat

NITSLDLSYNNFSGKLPRRF

ProfileScan: PS51450
IPR001611
489-512 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKHLKLSHNNFSGHFLPRETSFT

ProfileScan: PS51450
IPR001611
489-512 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKHLKLSHNNFSGHFLPRETSFT

ProfileScan: PS51450
IPR001611
489-512 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKHLKLSHNNFSGHFLPRETSFT

ProfileScan: PS51450
IPR001611
538-560 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLSVLDMSNNFLTGDIPSWMSNL

ProfileScan: PS51450
IPR001611
538-560 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLSVLDMSNNFLTGDIPSWMSNL

ProfileScan: PS51450
IPR001611
538-560 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLSVLDMSNNFLTGDIPSWMSNL

HMMPfam: PF00560
IPR001611
539-560 LRR_1
Leucine-rich repeat

LSVLDMSNNFLTGDIPSWMSNL

HMMPfam: PF00560
IPR001611
539-560 LRR_1
Leucine-rich repeat

LSVLDMSNNFLTGDIPSWMSNL

HMMPfam: PF00560
IPR001611
539-560 LRR_1
Leucine-rich repeat

LSVLDMSNNFLTGDIPSWMSNL

ProfileScan: PS51450
IPR001611
562-583 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTILSISNNFLEGTIPPSLLA

ProfileScan: PS51450
IPR001611
562-583 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTILSISNNFLEGTIPPSLLA

ProfileScan: PS51450
IPR001611
562-583 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTILSISNNFLEGTIPPSLLA

HMMPfam: PF00560
IPR001611
563-582 LRR_1
Leucine-rich repeat

LTILSISNNFLEGTIPPSLL

HMMPfam: PF00560
IPR001611
563-582 LRR_1
Leucine-rich repeat

LTILSISNNFLEGTIPPSLL

HMMPfam: PF00560
IPR001611
563-582 LRR_1
Leucine-rich repeat

LTILSISNNFLEGTIPPSLL

Gene3D: G3DSA:3.80.10.10
612-705 G3DSA:3.80.10.10

KLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPE

Gene3D: G3DSA:3.80.10.10
612-705 G3DSA:3.80.10.10

KLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPE

Gene3D: G3DSA:3.80.10.10
612-705 G3DSA:3.80.10.10

KLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPE

superfamily: SSF52058
613-885 SSF52058,LRR

LFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSC

superfamily: SSF52058
613-885 SSF52058,LRR

LFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSC

superfamily: SSF52058
613-885 SSF52058,LRR

LFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSC

ProfileScan: PS51450
IPR001611
631-653 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KVQILDLRYNQLSGSIPQFVNTE

ProfileScan: PS51450
IPR001611
631-653 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KVQILDLRYNQLSGSIPQFVNTE

ProfileScan: PS51450
IPR001611
631-653 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KVQILDLRYNQLSGSIPQFVNTE

HMMPfam: PF00560
IPR001611
632-649 LRR_1
Leucine-rich repeat

VQILDLRYNQLSGSIPQF

HMMPfam: PF00560
IPR001611
632-649 LRR_1
Leucine-rich repeat

VQILDLRYNQLSGSIPQF

HMMPfam: PF00560
IPR001611
632-649 LRR_1
Leucine-rich repeat

VQILDLRYNQLSGSIPQF

ProfileScan: PS51450
IPR001611
678-699 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIRLLDLSDNKLNGFIPSCLYN

ProfileScan: PS51450
IPR001611
678-699 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIRLLDLSDNKLNGFIPSCLYN

ProfileScan: PS51450
IPR001611
678-699 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIRLLDLSDNKLNGFIPSCLYN

Gene3D: G3DSA:3.80.10.10
773-881 G3DSA:3.80.10.10

MDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPT

Gene3D: G3DSA:3.80.10.10
773-881 G3DSA:3.80.10.10

MDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPT

Gene3D: G3DSA:3.80.10.10
773-881 G3DSA:3.80.10.10

MDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPT

HMMPfam: PF13855
774-828 LRR_8,Leucine rich repeat

DLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNML

HMMPfam: PF13855
774-828 LRR_8,Leucine rich repeat

DLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNML

HMMPfam: PF13855
774-828 LRR_8,Leucine rich repeat

DLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNML

ProfileScan: PS51450
IPR001611
793-814 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVMNLSCNFLSSSIPSSFSN

ProfileScan: PS51450
IPR001611
793-814 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVMNLSCNFLSSSIPSSFSN

ProfileScan: PS51450
IPR001611
793-814 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVMNLSCNFLSSSIPSSFSN

FPrintScan: PR00019
815-828 LEURICHRPT,Leucine-rich repeat signature

LKDIESLDLSHNML

FPrintScan: PR00019
815-828 LEURICHRPT,Leucine-rich repeat signature

LKDIESLDLSHNML

FPrintScan: PR00019
815-828 LEURICHRPT,Leucine-rich repeat signature

LKDIESLDLSHNML

ProfileScan: PS51450
IPR001611
817-840 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DIESLDLSHNMLQGSIPQQLTNLS

ProfileScan: PS51450
IPR001611
817-840 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DIESLDLSHNMLQGSIPQQLTNLS

ProfileScan: PS51450
IPR001611
817-840 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DIESLDLSHNMLQGSIPQQLTNLS

ProfileScan: PS51450
IPR001611
841-862 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVVFDVSYNNLSGIIPQGRQF

ProfileScan: PS51450
IPR001611
841-862 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVVFDVSYNNLSGIIPQGRQF

ProfileScan: PS51450
IPR001611
841-862 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVVFDVSYNNLSGIIPQGRQF


List of References

A Theologis, J R Ecker, C J Palm, N A Federspiel, S Kaul, O White, J Alonso, H Altafi, R Araujo, C L Bowman, S Y Brooks, E Buehler, A Chan, Q Chao, H Chen, R F Cheuk, C W Chin, M K Chung, L Conn, A B Conway, A R Conway, T H Creasy, K Dewar, P Dunn, P Etgu, T V Feldblyum, J Feng, B Fong, C Y Fujii, J E Gill, A D Goldsmith, B Haas, N F Hansen, B Hughes, L Huizar, J L Hunter, J Jenkins, C Johnson-Hopson, S Khan, E Khaykin, C J Kim, H L Koo, I Kremenetskaia, D B Kurtz, A Kwan, B Lam, S Langin-Hooper, A Lee, J M Lee, C A Lenz, J H Li, Y Li, X Lin, S X Liu, Z A Liu, J S Luros, R Maiti, A Marziali, J Militscher, M Miranda, M Nguyen, W C Nierman, B I Osborne, G Pai, J Peterson, P K Pham, M Rizzo, T Rooney, D Rowley, H Sakano, S L Salzberg, J R Schwartz, P Shinn, A M Southwick, H Sun, L J Tallon, G Tambunga, M J Toriumi, C D Town, T Utterback, S Van Aken, M Vaysberg, V S Vysotskaia, M Walker, D Wu, G Yu, C M Fraser, J C Venter, R W Davis
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Nature: 2000, 408(6814);816-20
PubMed:11130712 WorldCat.org DOI (P p)

A Theologis, J R Ecker, C J Palm, N A Federspiel, S Kaul, O White, J Alonso, H Altafi, R Araujo, C L Bowman, S Y Brooks, E Buehler, A Chan, Q Chao, H Chen, R F Cheuk, C W Chin, M K Chung, L Conn, A B Conway, A R Conway, T H Creasy, K Dewar, P Dunn, P Etgu, T V Feldblyum, J Feng, B Fong, C Y Fujii, J E Gill, A D Goldsmith, B Haas, N F Hansen, B Hughes, L Huizar, J L Hunter, J Jenkins, C Johnson-Hopson, S Khan, E Khaykin, C J Kim, H L Koo, I Kremenetskaia, D B Kurtz, A Kwan, B Lam, S Langin-Hooper, A Lee, J M Lee, C A Lenz, J H Li, Y Li, X Lin, S X Liu, Z A Liu, J S Luros, R Maiti, A Marziali, J Militscher, M Miranda, M Nguyen, W C Nierman, B I Osborne, G Pai, J Peterson, P K Pham, M Rizzo, T Rooney, D Rowley, H Sakano, S L Salzberg, J R Schwartz, P Shinn, A M Southwick, H Sun, L J Tallon, G Tambunga, M J Toriumi, C D Town, T Utterback, S Van Aken, M Vaysberg, V S Vysotskaia, M Walker, D Wu, G Yu, C M Fraser, J C Venter, R W Davis
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Nature: 2000, 408(6814);816-20
PubMed:11130712 WorldCat.org DOI (P p)

A Theologis, J R Ecker, C J Palm, N A Federspiel, S Kaul, O White, J Alonso, H Altafi, R Araujo, C L Bowman, S Y Brooks, E Buehler, A Chan, Q Chao, H Chen, R F Cheuk, C W Chin, M K Chung, L Conn, A B Conway, A R Conway, T H Creasy, K Dewar, P Dunn, P Etgu, T V Feldblyum, J Feng, B Fong, C Y Fujii, J E Gill, A D Goldsmith, B Haas, N F Hansen, B Hughes, L Huizar, J L Hunter, J Jenkins, C Johnson-Hopson, S Khan, E Khaykin, C J Kim, H L Koo, I Kremenetskaia, D B Kurtz, A Kwan, B Lam, S Langin-Hooper, A Lee, J M Lee, C A Lenz, J H Li, Y Li, X Lin, S X Liu, Z A Liu, J S Luros, R Maiti, A Marziali, J Militscher, M Miranda, M Nguyen, W C Nierman, B I Osborne, G Pai, J Peterson, P K Pham, M Rizzo, T Rooney, D Rowley, H Sakano, S L Salzberg, J R Schwartz, P Shinn, A M Southwick, H Sun, L J Tallon, G Tambunga, M J Toriumi, C D Town, T Utterback, S Van Aken, M Vaysberg, V S Vysotskaia, M Walker, D Wu, G Yu, C M Fraser, J C Venter, R W Davis
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Nature: 2000, 408(6814);816-20
PubMed:11130712 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox