PRGDB00061803 (NBS-LRR-like disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 283137480 (GU301917)
Gene Class Unknown
Domain Type
Gene Species Eleusine coracana

Comment?

Eleusine coracana NBS-LRR-like disease resistance protein gene, partial cds.

DNA Sequence

CCAAAAGGGAAGCAAAGTCATAATAACGACACGTATGGATCGCATAGTGGAAAAATTGGATTGTGGAGTTCTTGCAAATCAAGGAATAATCCGCCCTGTGCACAAGAGTGACTGGATTGAGTTGAAAAAATTATCGAATGAAGACTGCTGGGATGTGATGCGTCAAGCATTTAGAAGAGATGCTGACCTTAGTGGAGTTGAGGAAATTGGAAGAGAAATCGCTAGAAGTGTGTGGGCCTCA


Protein sequences

Name Description Sequence
NBS-LRR-like disease resistance protein NBS-LRR-like disease resistance protein [Eleusine coracana].

QKGSKVIITTRMDRIVEKLDCGVLANQGIIRPVHKSDWIELKKLSNEDCWDVMRQAFRRDADLSGVEEIGREIARSVWAS



List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox