PRGDB00061804 (NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 283137478 (GU301916)
Gene Class NL
Domain Type NBS, LRR
Gene Species Eleusine coracana

Comment?

Eleusine coracana NBS-LRR disease resistance protein gene, partial cds.

DNA Sequence

TGGGGGGGTGGGGAAGACGACTCTTGTTGATCATGTCTACAAGATTGTGAAAGAGGATTTCGATGTTGCTACTTGGGTAACTGTGTCAAAGAGCTACCAACTTGAAGACCTGCTGAAGAAGATTGCCAGAGGGTTGGGTATCTCAGTCCTTGATGTTAGTGACAGTGAAATGAGAAGCTTAGGGGATGCCATCAGTAACCATCTTCAAGGTACAAGTTATATGTTGGTCTTAGATGATGTTTGGGAAAAGGATCTGTGGATTGATATCATGGATATCTTTCCAAATAACAACTGCTCCAGCCGATTTGTTTTCACATCAAGAAATTTTGAAGTCGCATCGTTGGCTACTAGCAACTGCTCAATTAATCTGGCACCACTACAAGGAGATAACTCTTGGAAGTTGTTTTGCAATTTAACTTTTCGCAATGTGGAAGACAAAAGCTGCCCGTCGGAGTTGCGCAATTTAGCTGCAAAATTCCTAGAGAAGTGTGATGGCTTCCCCCTCGCCT


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Eleusine coracana].

GGVGKTTLVDHVYKIVKEDFDVATWVTVSKSYQLEDLLKKIARGLGISVLDVSDSEMRSLGDAISNHLQGTSYMLVLDDVWEKDLWIDIMDIFPNNNCSSRFVFTSRNFEVASLATSNCSINLAPLQGDNSWKLFCNLTFRNVEDKSCPSELRNLAAKFLEKCDGFPLA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF125
1-94 PTHR23155:SF125,PUTATIVE RPR1 (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01G0547000 PROTEIN)

GGVGKTTLVDHVYKIVKEDFDVATWVTVSKSYQLEDLLKKIARGLGISVLDVSDSEMRSLGDAISNHLQGTSYMLVLDDVWEKDLWIDIMDIFP

HMMPfam: PF00931
IPR002182
1-169 NB-ARC,NBS
NB-ARC

GGVGKTTLVDHVYKIVKEDFDVATWVTVSKSYQLEDLLKKIARGLGISVLDVSDSEMRSLGDAISNHLQGTSYMLVLDDVWEKDLWIDIMDIFPNNNCSSRFVFTSRNFEVASLATSNCSINLAPLQGDNSWKLFCNLTFRNVEDKSCPSELRNLAAKFLEKCDGFPLA

superfamily: SSF52540
1-169 SSF52540

GGVGKTTLVDHVYKIVKEDFDVATWVTVSKSYQLEDLLKKIARGLGISVLDVSDSEMRSLGDAISNHLQGTSYMLVLDDVWEKDLWIDIMDIFPNNNCSSRFVFTSRNFEVASLATSNCSINLAPLQGDNSWKLFCNLTFRNVEDKSCPSELRNLAAKFLEKCDGFPLA

HMMPanther: PTHR23155
1-94 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLVDHVYKIVKEDFDVATWVTVSKSYQLEDLLKKIARGLGISVLDVSDSEMRSLGDAISNHLQGTSYMLVLDDVWEKDLWIDIMDIFP

Gene3D: G3DSA:3.40.50.300
2-108 G3DSA:3.40.50.300

GVGKTTLVDHVYKIVKEDFDVATWVTVSKSYQLEDLLKKIARGLGISVLDVSDSEMRSLGDAISNHLQGTSYMLVLDDVWEKDLWIDIMDIFPNNNCSSRFVFTSRN


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox