PRGDB00061805 (Contains similarity to NBS/LRR disease resistance protein gi|3309619 from Arabidopsis thaliana gb|AF074916 and contains a NB-ARC PF|00931 domain and multiple Leucine Rich PF|00560 Repeats.)

From PRG Wiki
Jump to: navigation, search

3309619 from Arabidopsis thaliana gb|AF074916 and contains a NB-ARC PF|00931 domain and multiple Leucine Rich PF|00560 Repeats.|{| style="width: 30em; font-size: 90%; border: 1px solid #aaaaaa; background-color: #f9f9f9; color: black; margin-bottom: 0.5em; margin-left: 1em; padding: 0.2em; float: right; clear: right; text-align:left;" ! style="text-align: center; background-color:#ccccff;" colspan="2" |Contains similarity to NBS/LRR disease resistance protein gi|3309619 from Arabidopsis thaliana gb|AF074916 and contains a NB-ARC PF|00931 domain and multiple Leucine Rich PF|00560 Repeats.

|- ! Gene Type | Putative_R-Genes,_collected_from_NCBI_Protein |- ! GenBank | 8099275 (AC034256) |- ! Gene Class | CNL |- ! Domain Type | NBS, LRR, Others

|- ! Gene Species | Arabidopsis thaliana |- ! |

Comment?

|}Sequence of BAC F7H2 from Arabidopsis thaliana chromosome 1, complete sequence.

DNA Sequence

ATGGCTCGAGTCCTAGAAGCTTACCGGGTTCTCTCATCAAACTGCTCCATTCGGATATACTTCCACTCTCAAGTCTCACTCCCTCACAATCAATTCAAGCGATTGCCGCCCGTCGTCGCTTTCAAATTTGTTCTTCCGCCGGAGATTTTTTATGGCGGAGGGACAATTGACGAACATATCGGAGATGATACTGAAGAAGAGGAAGAAAGGGATGAGCTTGAATTGACACTAGAAATATCTTGTGATCAAACGTTGAATCATGCTTGTGGCTGCTTATTTGGTGATCGGAATTACATTCTCAAGATGGAGGCTAATCTCGAGGCTCTGCAGAATACTATGCAAGAGCTCGAGGAGAGAAGAGATGATCTGTTAAGAAGAGTTGTCATAGAAGAAGACAAAGGTTTGCAACGGCTTGCTCAAGTTCAAGGTTGGCTTTCAAGGGTTAAAGATGTTTGTTCTCAAGTCAATGATCTGCTGAAAGCTAAATCAATTCAAACTGAAAGGTTATGTCTCTGTGGATATTGTTCTAAGAATTTCATATCTGGCCGCAATTACGGAATAAATGTACTGAAAAAGTTGAAACACGTGGAAGGACTTCTAGCTAAAGGAGTTTTTGAAGTGGTGGCAGAGAAAATTCCTGCGCCTAAGGTGGAGAAGAAGCATATCCAAACCACAGTTGGGTTGGATGCAATGGTCGGAAGGGCATGGAACAGCCTCATGAAAGATGAACGAAGAACTTTGGGTCTTTATGGTATGGGGGGAGTAGGTAAAACCACGCTCTTAGCTTCTATTAACAACAAATTCCTTGAAGGGATGAATGGATTTGATCTTGTTATATGGGTTGTGGTTTCTAAAGATTTGCAAAATGAAGGCATTCAAGAACAGATTTTAGGAAGACTAGGTCTTCACAGGGGATGGAAACAAGTTACAGAAAAGGAGAAAGCCTCTTACATATGCAACATCCTCAACGTAAAGAAATTTGTGCTGTTATTGGATGATCTATGGAGCGAAGTAGATTTAGAAAAGATTGGAGTTCCACCTCTAACGCGAGAAAATGGATCCAAAATAGTTTTCACCACTCGTTCTAAAGATGTTTGCAGAGATATGGAAGTTGATGGTGAGATGAAAGTTGATTGTTTGCCACCGGATGAAGCCTGGGAACTGTTCCAAAAGAAAGTTGGACCAATCCCATTACAGAGCCATGAGGATATTCCCACACTTGCAAGAAAAGTAGCAGAAAAATGTTGTGGCTTGCCACTTGCACTCAGTGTCATTGGCAAAGCTATGGCATCTAGAGAGACTGTTCAGGAATGGCAGCATGTGATTCATGTTCTGAACTCGTCTAGCCACGAGTTCCCAAGTATGGAAGAAAAAATTCTTCCTGTTTTGAAGTTCAGTTATGATGATTTAAAAGATGAAAAAGTCAAATTGTGCTTCCTTTATTGTTCCCTGTTTCCGGAAGATTATGAAGTAAGAAAGGAAGAGTTGATAGAATATTGGATGTGTGAAGGATTTATAGATGGGAATGAAGATGAAGATGGAGCTAACAACAAAGGTCATGACATAATTGGCTCGTTAGTTCGTGCACATCTATTGATGGATGGTGAACTAACAACAAAAGTGAAAATGCATGATGTCATACGCGAGATGGCTCTTTGGATAGCGTCGAACTTTGGAAAACAGAAAGAAACACTTTGTGTGAAACCCGGTGTGCAGTTATGCCATATACCAAAGGACATCAATTGGGAAAGTTTGAGAAGGATGTCTTTGATGTGCAATCAGATTGCAAATATATCTTCTAGTTCCAACTCTCCCAACCTCTCAACTCTATTACTCCAGAATAACAAGTTGGTGCATATATCATGTGACTTTTTTAGGTTTATGCCAGCACTCGTGGTCTTGGATCTTTCGAGGAACTCGAGTCTCTCTAGCTTGCCGGAAGCAATTTCTAAGTTAGGTTCCTTGCAATATATCAACTTATCAACAACAGGGATAAAATGGTTGCCAGTTAGTTTTAAGGAGTTGAAGAAATTAATCCATTTGAATCTGGAGTTTACTGATGAACTTGAAAGTATTGTTGGGATAGCTACAAGCCTACCAAACCTGCAAGTGTTGAAATTGTTTTCTTCTCGTGTTTGTATTGATGGCAGTTTAATGGAAGAGTTACTACTCTTGGAGCACTTGAAGGTTTTAACAGCAACTATAAAGGACGCCTTGATTTTGGAAAGTATACAAGGAGTGGACCGATTGGTGAGTAGTATTCAAGCTTTATGTCTCAGAAATATGTCAGCACCGGTTATAATATTGAACACGGTAGCTCTGGGTGGTCTTCAACACCTTGAAATCGTGGGCTCCAAAATCTCAGAGATAAAGATAGATTGGGAAAGAAAAGGAAGAGGGGAGCTTAAATGTACAAGTTCTCCTGGCTTTAAGCACCTCTCTGTTGTTGAAATATTCAATTTGGAAGGTCCAAGGGATTTAACATGGCTGTTGTTTGCTCAAAACCTCAGGCGTCTATCTGTGACGCTGTCATTAACCATAGAAGAGATAATAAACAAGGAGAAAGGAATGAGTATTACCAATGTGCATCCAAATATCGTTGTTCCGTTTGGGAAGCTGGAATTCCTTGAAGTAAGGGGTTTGGATGAGTTAAAGAGAATCTGCTGGAATCCCCCGGCTCTTCCAAACCTGAGACAATTTGATGTACGAAGCTGCCTTAAGCTACCGGAAGCTGCCACTGAGTTTCCGCGACATGCCAATGAATAA


Protein sequences

Name Description Sequence
AF074916 and contains a NB-ARC PF|00931 domain and multiple Leucine Rich PF|00560 Repeats. AF074916 and contains a NB-ARC PF|00931 domain and multiple Leucine Rich PF|00560 Repeats.

MARVLEAYRVLSSNCSIRIYFHSQVSLPHNQFKRLPPVVAFKFVLPPEIFYGGGTIDEHIGDDTEEEEERDELELTLEISCDQTLNHACGCLFGDRNYILKMEANLEALQNTMQELEERRDDLLRRVVIEEDKGLQRLAQVQGWLSRVKDVCSQVNDLLKAKSIQTERLCLCGYCSKNFISGRNYGINVLKKLKHVEGLLAKGVFEVVAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHVIHVLNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFLYCSLFPEDYEVRKEELIEYWMCEGFIDGNEDEDGANNKGHDIIGSLVRAHLLMDGELTTKVKMHDVIREMALWIASNFGKQKETLCVKPGVQLCHIPKDINWESLRRMSLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTTGIKWLPVSFKELKKLIHLNLEFTDELESIVGIATSLPNLQVLKLFSSRVCIDGSLMEELLLLEHLKVLTATIKDALILESIQGVDRLVSSIQALCLRNMSAPVIILNTVALGGLQHLEIVGSKISEIKIDWERKGRGELKCTSSPGFKHLSVVEIFNLEGPRDLTWLLFAQNLRRLSVTLSLTIEEIINKEKGMSITNVHPNIVVPFGKLEFLEVRGLDELKRICWNPPALPNLRQFDVRSCLKLPEAATEFPRHANE

Domains

Domain Start-End Description Sequence

Seg: seg
55-79 seg

TIDEHIGDDTEEEEERDELELTLEI

HMMPanther: PTHR23155:SF113
70-908 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

RDELELTLEISCDQTLNHACGCLFGDRNYILKMEANLEALQNTMQELEERRDDLLRRVVIEEDKGLQRLAQVQGWLSRVKDVCSQVNDLLKAKSIQTERLCLCGYCSKNFISGRNYGINVLKKLKHVEGLLAKGVFEVVAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHVIHVLNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFLYCSLFPEDYEVRKEELIEYWMCEGFIDGNEDEDGANNKGHDIIGSLVRAHLLMDGELTTKVKMHDVIREMALWIASNFGKQKETLCVKPGVQLCHIPKDINWESLRRMSLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTTGIKWLPVSFKELKKLIHLNLEFTDELESIVGIATSLPNLQVLKLFSSRVCIDGSLMEELLLLEHLKVLTATIKDALILESIQGVDRLVSSIQALCLRNMSAPVIILNTVALGGLQHLEIVGSKISEIKIDWERKGRGELKCTSSPGFKHLSVVEIFNLEGPRDLTWLLFAQNLRRLSVTLSLTIEEIINKEKGMSITNVHPNIVVPFGKLEFLEVRGLDELKRICWNPPALPNLRQFDVRSCLKL

HMMPanther: PTHR23155
70-908 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RDELELTLEISCDQTLNHACGCLFGDRNYILKMEANLEALQNTMQELEERRDDLLRRVVIEEDKGLQRLAQVQGWLSRVKDVCSQVNDLLKAKSIQTERLCLCGYCSKNFISGRNYGINVLKKLKHVEGLLAKGVFEVVAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHVIHVLNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFLYCSLFPEDYEVRKEELIEYWMCEGFIDGNEDEDGANNKGHDIIGSLVRAHLLMDGELTTKVKMHDVIREMALWIASNFGKQKETLCVKPGVQLCHIPKDINWESLRRMSLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTTGIKWLPVSFKELKKLIHLNLEFTDELESIVGIATSLPNLQVLKLFSSRVCIDGSLMEELLLLEHLKVLTATIKDALILESIQGVDRLVSSIQALCLRNMSAPVIILNTVALGGLQHLEIVGSKISEIKIDWERKGRGELKCTSSPGFKHLSVVEIFNLEGPRDLTWLLFAQNLRRLSVTLSLTIEEIINKEKGMSITNVHPNIVVPFGKLEFLEVRGLDELKRICWNPPALPNLRQFDVRSCLKL

Coil: coil
99-134 coiled-coil

ILKMEANLEALQNTMQELEERRDDLLRRVVIEEDKG

Seg: seg
115-126 seg

ELEERRDDLLRR

superfamily: SSF52540
205-441 P-loop containing nucleoside triphosphate hydrolases

FEVVAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHV

HMMPfam: PF00931
IPR002182
229-507 NB-ARC,NBS
NB-ARC

DAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHVIHVLNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFLYCSLFPEDYEVRKEELIEYWMCEGFID

Gene3D: G3DSA:3.40.50.300
236-366 no description

WNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVC

FPrintScan: PR00364
IPR000767
246-261 DISEASERSIST
Disease resistance protein

TLGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
321-335 DISEASERSIST
Disease resistance protein

ILNVKKFVLLLDDLW

FPrintScan: PR00364
IPR000767
415-429 DISEASERSIST
Disease resistance protein

CCGLPLALSVIGKAM

superfamily: SSF52058
542-905 L domain-like,LRR

KMHDVIREMALWIASNFGKQKETLCVKPGVQLCHIPKDINWESLRRMSLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTTGIKWLPVSFKELKKLIHLNLEFTDELESIVGIATSLPNLQVLKLFSSRVCIDGSLMEELLLLEHLKVLTATIKDALILESIQGVDRLVSSIQALCLRNMSAPVIILNTVALGGLQHLEIVGSKISEIKIDWERKGRGELKCTSSPGFKHLSVVEIFNLEGPRDLTWLLFAQNLRRLSVTLSLTIEEIINKEKGMSITNVHPNIVVPFGKLEFLEVRGLDELKRICWNPPALPNLRQFDVRSC

Seg: seg
593-615 seg

NQIANISSSSNSPNLSTLLLQNN

HMMPfam: PF13855
605-663 LRR_8,Leucine rich repeat

PNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTT

FPrintScan: PR00364
IPR000767
626-642 DISEASERSIST
Disease resistance protein

RFMPALVVLDLSRNSSL

Seg: seg
631-645 seg

LVVLDLSRNSSLSSL

Seg: seg
718-731 seg

LMEELLLLEHLKVL

Gene3D: G3DSA:3.80.10.10
856-857 no description

GM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox