PRGDB00061806 (Contains a weak similarity to disease resistance protein (cf-5) gene from Lycopersicon esculentum gb|AF053993 and contains multiple leucine rich PF|00560 repeats and protein kinase PF|00069 domain. EST gb|T04455 comes from this gene.)

From PRG Wiki
Jump to: navigation, search

AF053993 and contains multiple leucine rich PF|00560 repeats and protein kinase PF|00069 domain. EST gb|T04455 comes from this gene.|{| style="width: 30em; font-size: 90%; border: 1px solid #aaaaaa; background-color: #f9f9f9; color: black; margin-bottom: 0.5em; margin-left: 1em; padding: 0.2em; float: right; clear: right; text-align:left;" ! style="text-align: center; background-color:#ccccff;" colspan="2" |Contains a weak similarity to disease resistance protein (cf-5) gene from Lycopersicon esculentum gb|AF053993 and contains multiple leucine rich PF|00560 repeats and protein kinase PF|00069 domain. EST gb|T04455 comes from this gene.

|- ! Gene Type | Putative_R-Genes,_collected_from_NCBI_Protein |- ! GenBank | 7109457 (AC018748) |- ! Gene Class | RLP |- ! Domain Type | Ser-Thr Kinase, LRR

|- ! Gene Species | Arabidopsis thaliana |- ! |

Comment?

|}Sequence of BAC T3F20 from Arabidopsis thaliana chromosome 1, complete sequence.

DNA Sequence

AGGTTACATGGCTCCAGAGTATGCAATGAGAGGTTACTTAACAGACAAAGCAGATGTTTATAGCTTCGGTGTAGTCTGTTTAGAGATTGTTAGCGGAAAGAGCAACACAAATTACAGACCAAAAGAAGAGTTTATTTACCTTCTTGACTGGGCATATGTCTTGCAAGAACAAGGGAGTCTTCTAGAACTCGTGGATCCAGATCTCGGTACAAGCTTTTCGAAGAAAGAAGCAATGAGGATGTTGAACATAGCTTTACTCTGTACAAACCCATCTCCAACATTGAGACCACCGATGTCATCTGTTGTAAGTATGCTACAAGGAAAAATCAAAGTCCAACCACCACTGGTGAAACGTGAAGCTGATCCAAGTGGTTCAGCCGCAATGAGGTTTAAGGCCTTAGAGCATTTGTCACAAGACAGCGAGTCACAAGTCTCAACCTATACAAGAAACAAAGAACACAAAAGCTCCTCCTCGATGGACGGTCCTTGGGTCGATTCTTCCTTCTCTGATCCGAGCAAAGATGTTAGCCTATTACAGCAAGAAGAAGGAAATTCATCATCTTCGTCGAGGAGACTGTTAGATGATCTTACTGATGTGGAGATTGAGTAAGCACAGAGAAACAAAGACTTCACTTGGATTGGTCCACGAGGAACAAGGTATGCATAGGGATTGCGAAAGGATTGGCTTATCTACACGAGGAATCAAGGCTGAAGATTGTGCACAGAGACATTAAAGCGACAAATGTGCTTCTTGATCTGTCTCTAAATGCTAAGATCTCTGATTTTGGTCTAGCGAAACTCGATGAAGAAGAGAATACACATATCAGCACAAGGATTGCAGGAACAATGGTGTTCTCGCTGATGGGATGACCATAGCGGTGAAGCAGCTTTCATCGAAATCTAAGCAAGGAAACCGAGAATTTGTGACTGAGATCGGTATGATATCTGCGTTGCAACACCCTAATCTTGTGAAACTTTATGGTTGTTGCATCGAAGGGAAAGAGCTTTTGCTTGTGTATGAATACTTAGAGAACAACAGTCTCGCTCGCGCACTCTTTGAAGAGCTTCGGGGACTCGATTTGCAGACAGGATCGTTCACATTGAAGCAAATCAAACGTGCTACTAACAACTTTGATCCAGAAAACAAGATTGGAGAAGGAGGATTTGGACCGGTTTATAAGATTTCAAGGTTGATACCGGAAAACCATTGTCCAATGGAGTAGTTGCAGGCATTGTAATCGCAGCGTGTGTAGCTTTCGGGTTGCTGGTACTTGTAATCCTCAGGCTAACAGGTTACTTAGGTGGAAAAGAAGTGGATGAAAATGGGGATTTTGTTGGAGAGGGACTTTAACATAGCACAGAGAGCAGGTGGAGTTGGTAAACCGTTCCTAAGGCAAGTTGATGAAGTTCAAGTGAATGGAAGTACGTTGGAGATTCATTTGAAGTGGACAGGAAAAGGCACAAACGTAATACCAACAAGAGGTGTTTACGGGCCTCTCATATCCGCTATAACCGTCACACCGAATTCTTCCTTGTTCATTAACTGTGGAGGAAACCGACTCAAGGTTGATAAAGACGAGTATGCGGATGACTTAAACAAAAGAGGAGCATCAACATTCTCTTCTGTCTCTGAAAGATGGGGATACAGTAGTTCTGGAGCTTGGTTAGGCAATGACGGTGCCACTTACTTAGCAACAGATACGTTTAACTTGATCAATGAATCAACTCCAGAGTATTACAAAACAGCCCGTCTCGCTTCACAATCACTCAAGTACTATGGACTATGCATGAGAAGAGGAAGTTACAAAGTTCAGCTCTATTTTGCAGAGATAATGTTCTCAAATGATCAGACTTATAGTAGCTTAGGGCGGCGACTATTCGACATTTATGTTCAATGTCCAATGGTGCTTAAGAAAGGATCTTCCGTGTCCTGGAGACGCACACCGTATCTGAATAATAACTCATTGACTGGTCCAGTTCCTCAGTTCATTCTTGATAGTAAACAAAACATAGATTTAAGCTCAAACATGTTAAATGGTACAATTCCAGACACATTTCGGAGTCTGAACGCATTCAACTTTATGGTACTAAGAAACTGTTTGATAAGGGAACCTATACCGGAGTACATCGGTACTTCCATGACTATGTTGAAGTTACTGAGGATAACAGATTTGCGTGGACCAACTTCTCCTTTTCCAGACCTTCAAAATATGACGAATATGGAAAGATTAGACCTCCAAGGCACATCAATGGAAGGTCCTATTCCAGCTTCGATTTCAAACTTGAAAAACCTGACTGAATTTCGGATTGATGGAAACTCTCTATCTGGGAAGATACCTGATTTTATTGGAAACTGGACTCGGCTCGTTAGGCTGCTAATCTCTTCAAATAACATCACGGGTCGGATCCCTGAGTCCTTGAGCAATCTCAAGAATTTGACTAATTTGATTATGGAAAGTAATTTATTCACAGGACAACTTCCTCCAAACCTAGGGAACTTAAGAAGCTTGAAAAGATTGGCTGTAACCGGAAACCGACTCTCTGGACCATTTCCTCCTCAGCTCGGACAGATTACTACACTTACTGATGTACAGCTTAGAGGTTTCAATTTGCGAGGAATTATACCGCCTGAATTCGGGAACCTCACACGTCTTACAGAGATTTCAAACATTGCGAACGATCTTTAGAAAGCTTCAAAACCAAACAGTGAACATCGAAAGAACTTCTTGTTTGGACAGAAAATGGAACTTTGTTGCCGAGTCAACCTCCAAGCTACCAACCAGTAACATTACCTGCGACTGTACTTTCAACGCCAGCTCAGTCTGTCGTGTCACAAACATATGGGTTTCTTTTTCTCGACCCGGAAAGGTCTTCTTCTCATCATCTTCATTTGCTTGGATATTTTCGGATCAAATGCTCAACTTTTGCCAGAAGATGAAG


Protein sequences

Name Description Sequence
00560 repeats and protein kinase PF|00069 domain. EST gb|T04455 comes from this gene. 00560 repeats and protein kinase PF|00069 domain. EST gb|T04455 comes from this gene [Arabidopsis thaliana]

MGFFFSTRKGLLLIIFICLDIFGSNAQLLPEDEVQTLRTIFRKLQNQTVNIERTSCLDRKWNFVAESTSKLPTSNITCDCTFNASSVCRVTNIQLRGFNLRGIIPPEFGNLTRLTEMAVTGNRLSGPFPPQLGQITTLTDVIMESNLFTGQLPPNLGNLRSLKRLLISSNNITGRIPESLSNLKNLTNFRIDGNSLSGKIPDFIGNWTRLVRLDLQGTSMEGPIPASISNLKNLTELRITDLRGPTSPFPDLQNMTNMERLVLRNCLIREPIPEYIGTSMTMLKLLDLSSNMLNGTIPDTFRSLNAFNFMYLNNNSLTGPVPQFILDSKQNIVQWCLRKDLPCPGDAHHSSLFINCGGNRLKVDKDEYADDLNKRGASTFSSVSERWGYSSSGAWLGNDGATYLATDTFNLINESTPEYYKTARLASQSLKYYGLCMRRGSYKVQLYFAEIMFSNDQTYSSLGRRLFDIYVQGILLERDFNIAQRAGGVGKPFLRQVDEVQVNGSTLEIHLKWTGKGTNVIPTRGVYGPLISAITVTPNFKVDTGKPLSNGVVAGIVIAACVAFGLLVLVILRLTGYLGGKEVDENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQGKIKVQPPLVKREADPSGSAAMRFKALEHLSQDSESQVSTYTRNKEHKSSSSMDGPWVDSSFSDPSKDVSLLQQEEGNSSSSSRRLLDDLTDVEIE

Domains

Domain Start-End Description Sequence

Seg: seg
11-22 seg

LLLIIFICLDIF

HMMPanther: PTHR24420:SF696
11-961 LEUCINE-RICH REPEAT FAMILY PROTEIN / PROTEIN KINASE FAMILY PROTEIN

LLLIIFICLDIFGSNAQLLPEDEVQTLRTIFRKLQNQTVNIERTSCLDRKWNFVAESTSKLPTSNITCDCTFNASSVCRVTNIQLRGFNLRGIIPPEFGNLTRLTEMAVTGNRLSGPFPPQLGQITTLTDVIMESNLFTGQLPPNLGNLRSLKRLLISSNNITGRIPESLSNLKNLTNFRIDGNSLSGKIPDFIGNWTRLVRLDLQGTSMEGPIPASISNLKNLTELRITDLRGPTSPFPDLQNMTNMERLVLRNCLIREPIPEYIGTSMTMLKLLDLSSNMLNGTIPDTFRSLNAFNFMYLNNNSLTGPVPQFILDSKQNIVQWCLRKDLPCPGDAHHSSLFINCGGNRLKVDKDEYADDLNKRGASTFSSVSERWGYSSSGAWLGNDGATYLATDTFNLINESTPEYYKTARLASQSLKYYGLCMRRGSYKVQLYFAEIMFSNDQTYSSLGRRLFDIYVQGILLERDFNIAQRAGGVGKPFLRQVDEVQVNGSTLEIHLKWTGKGTNVIPTRGVYGPLISAITVTPNFKVDTGKPLSNGVVAGIVIAACVAFGLLVLVILRLTGYLGGKEVDENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQGKIKVQPPLVKREADPSGSAAMRFKALEHLSQDSESQVSTYTRNKEHKSSSSMDGPWVDSSFSDPSKDVSLLQQEEGN

HMMPanther: PTHR24420
11-961 FAMILY NOT NAMED,FAMILY NOT NAMED

LLLIIFICLDIFGSNAQLLPEDEVQTLRTIFRKLQNQTVNIERTSCLDRKWNFVAESTSKLPTSNITCDCTFNASSVCRVTNIQLRGFNLRGIIPPEFGNLTRLTEMAVTGNRLSGPFPPQLGQITTLTDVIMESNLFTGQLPPNLGNLRSLKRLLISSNNITGRIPESLSNLKNLTNFRIDGNSLSGKIPDFIGNWTRLVRLDLQGTSMEGPIPASISNLKNLTELRITDLRGPTSPFPDLQNMTNMERLVLRNCLIREPIPEYIGTSMTMLKLLDLSSNMLNGTIPDTFRSLNAFNFMYLNNNSLTGPVPQFILDSKQNIVQWCLRKDLPCPGDAHHSSLFINCGGNRLKVDKDEYADDLNKRGASTFSSVSERWGYSSSGAWLGNDGATYLATDTFNLINESTPEYYKTARLASQSLKYYGLCMRRGSYKVQLYFAEIMFSNDQTYSSLGRRLFDIYVQGILLERDFNIAQRAGGVGKPFLRQVDEVQVNGSTLEIHLKWTGKGTNVIPTRGVYGPLISAITVTPNFKVDTGKPLSNGVVAGIVIAACVAFGLLVLVILRLTGYLGGKEVDENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQGKIKVQPPLVKREADPSGSAAMRFKALEHLSQDSESQVSTYTRNKEHKSSSSMDGPWVDSSFSDPSKDVSLLQQEEGN

superfamily: SSF52058
27-322 L domain-like,LRR

QLLPEDEVQTLRTIFRKLQNQTVNIERTSCLDRKWNFVAESTSKLPTSNITCDCTFNASSVCRVTNIQLRGFNLRGIIPPEFGNLTRLTEMAVTGNRLSGPFPPQLGQITTLTDVIMESNLFTGQLPPNLGNLRSLKRLLISSNNITGRIPESLSNLKNLTNFRIDGNSLSGKIPDFIGNWTRLVRLDLQGTSMEGPIPASISNLKNLTELRITDLRGPTSPFPDLQNMTNMERLVLRNCLIREPIPEYIGTSMTMLKLLDLSSNMLNGTIPDTFRSLNAFNFMYLNNNSLTGPVP

Gene3D: G3DSA:3.80.10.10
76-324 no description

ITCDCTFNASSVCRVTNIQLRGFNLRGIIPPEFGNLTRLTEMAVTGNRLSGPFPPQLGQITTLTDVIMESNLFTGQLPPNLGNLRSLKRLLISSNNITGRIPESLSNLKNLTNFRIDGNSLSGKIPDFIGNWTRLVRLDLQGTSMEGPIPASISNLKNLTELRITDLRGPTSPFPDLQNMTNMERLVLRNCLIREPIPEYIGTSMTMLKLLDLSSNMLNGTIPDTFRSLNAFNFMYLNNNSLTGPVPQF

HMMPfam: PF00560
IPR001611
161-183 LRR_1
Leucine-rich repeat

SLKRLLISSNNITGRIPESLSNL

HMMPfam: PF00560
IPR001611
283-304 LRR_1
Leucine-rich repeat

LKLLDLSSNMLNGTIPDTFRSL

HMMPfam: PF11721
IPR021720
351-534 Malectin
Malectin

SLFINCGGNRLKVDKDEYADDLNKRGASTFSSVSERWGYSSSGAWLGNDGATYLATDTFNLINESTPEYYKTARLASQSLKYYGLCMRRGSYKVQLYFAEIMFSNDQTYSSLGRRLFDIYVQGILLERDFNIAQRAGGVGKPFLRQVDEVQVNGSTLEIHLKWTGKGTNVIPTRGVYGPLISAI

Seg: seg
551-563 seg

GVVAGIVIAACVA

superfamily: SSF56112
IPR011009
581-890 Protein kinase-like (PK-like)
Protein kinase-like domain

KEVDENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQGKIKVQP

Gene3D: G3DSA:3.30.200.20
598-672 no description

SFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYG

ProfileScan: PS50011
IPR000719
611-892 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQGKIKVQPPL

HMMSmart: SM00219
IPR020635
611-882 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSML

HMMSmart: SM00220
IPR002290
611-880 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVS

HMMPfam: PF07714
IPR001245
614-882 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSML

Gene3D: G3DSA:1.10.510.10
673-879 no description

CCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVV

Seg: seg
679-692 seg

ELLLVYEYLENNSL

PatternScan: PS00108
IPR008271
733-745 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKATNVLL

Seg: seg
953-973 seg

SLLQQEEGNSSSSSRRLLDDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox