PRGDB00061807 (Strong similarity to gb|AF098963 disease resistance protein RPP1-WsB from Arabidopsis thaliana and contains 2 PF|00931 NB-ARC domains and 5 PF|00560 Leucine Rich Repeats.)

From PRG Wiki
Jump to: navigation, search

AF098963 disease resistance protein RPP1-WsB from Arabidopsis thaliana and contains 2 PF|00931 NB-ARC domains and 5 PF|00560 Leucine Rich Repeats.|{| style="width: 30em; font-size: 90%; border: 1px solid #aaaaaa; background-color: #f9f9f9; color: black; margin-bottom: 0.5em; margin-left: 1em; padding: 0.2em; float: right; clear: right; text-align:left;" ! style="text-align: center; background-color:#ccccff;" colspan="2" |Strong similarity to gb|AF098963 disease resistance protein RPP1-WsB from Arabidopsis thaliana and contains 2 PF|00931 NB-ARC domains and 5 PF|00560 Leucine Rich Repeats.

|- ! Gene Type | Putative_R-Genes,_collected_from_NCBI_Protein |- ! GenBank | 6056179 (AC009513) |- ! Gene Class | TNL |- ! Domain Type | NBS, TIR, LRR, Others

|- ! Gene Species | Arabidopsis thaliana |- ! |

Comment?

|}Sequence of BAC F12P19 from Arabidopsis thaliana chromosome 1, complete sequence.

DNA Sequence

ATGACATCCATGATAGCTTCTCGCCAACAGAGTCAACGCTCCTGTCCAATATGCGCAACACCTTTTCCTTCATCATCTTCGTCCCACAAGTGGACACATCAAGTCTTTCCAAGCTTCCGTGGGGAAGATGTACGTAGAGGTTTTCTCAGTCATATTCACAAGGAGTTTCAAAGAAAGGGAATTACACCATTCATTGATAATGAGATCAAGAGAGGAGAATCCATTGGTCTTGAAATCATACATGCGATTAGAGAATCTAAGATCGCGATTGTCTTGCTCTCTAGGAACTATGCTTCTTCATCTTGGTGTCTTGACGAGTTGGTGGAGATCATGAAATGCAAAGAAGAATTTAGTCAAATAGTGATCCCCATTTTCTATAGAGTGGATCCATCCGATGTTAAGAAGCTCACAGGAAATTTTGGGAATGTCTTCAAAAATAATTGTGTTGGTAAAACTAATGAGGTTATAAGGAAATGGAGACAAGCTCTGGCAAAAATGGGAACAACCACTGGTTACGATTCTCGCAACTGGGATAATGAAGCGACCATGATTGAAAACATTGCCACTGATATTTCGAATATGCTGAATTATTCTACGCCATCACGTGATTTTGACGGTTTAATTGGGATGAGAGCTCATATGAAAGTAATGGAACCGATGTTATGCCTACACTCCGATGAAGTGAGGATGATTGGAATTTGGGGTCCTTCTGGGATCGGGAAAACTACCATTGCTAGAATCTTATTTAGCCAATTTAGCGACAGTTTTGAATTGAGTGTCTTTATGGAGAATGTTAAGGAGTTAATGTATACAAGACCGGTGTGTTCTGATGAATACAGTGCAAAGTTACACTTACAGAAACAGTTCATGTCCCAGATTATCAACCACAAAGATATCGAGATTCCTCACCTAGGAGTTGTAGAAGATAGATTGAAAGACAAGAAAGTGTTTATTGTTCTTGATAATATCGACCAGTCAATACAACTAGATGCTATTGCAAAAGAAAGTCGATGGTTTGGTCATGGAAGTCGGATTATCATCACAACACAAGACCGGAAACTTTTGAAGGCACATGATGGCATCAACCATATTTACAACGTAAATTTTCCATCAGCATATGAAGCTTGCCAAATATTTTGTATGTATGCTTTTGGACAAAAATTTCCTAAAGATGGTTTCGAAGAGCTTGCATGGGAAGTTGCAAAACTTTTAGGTGGACTACCATTGGGTTTAAGAGTTATGGGCTCTCATTTTCGGGGAATGTCTAAACATGAGTGGATAAATGCCCTACCGAGGTTAAGGACTCGCCTTGATGCCAATATTCAAAGCATCTTAAAGTTTAGTTACAATGCCTTGTGTGAAGAAGATAAAGACTTATTTCTTTATATAGCATGCCTTTTCAACAATAAAAGGATTGAAAAAGTGGAAGAGCATCTTGCAGAGAAGTCCCTGAATGTGAAGCAAGGACTTCACGTTTTAACTGAAAAATCTCTCATATCTATTGAAGGGGGAAGAATAAAGATGCATAATTTGCTAGAACAATTGGGTAAAGAAATTGTTCGTCATGGGCTCGGGCATCAACCCATTCGTGAACCTGGGAAACGTCAATTTTTGGTTGATACTAGAGATATTTGTGAACTACTCACTAATGACACGGGTAGTAAAAGTGTTATAGGCATACATTTCTACTCATCCGAGCTCTCAAGCGAATTAAATATAAGTGAGAGAGCTTTTGAAGGAATGCCTAACCTTAAATTCTTAAGATTCTACTACCGCTATGGTGACGAGAGTGATAAATTGTACTTACCACAAGGTTTGAATTATCTATCTCAAAAACTTAAAATACTAGAATGGGATCATTTTCCGTTGACATGTATGCCTTCCAATTTTTGTACGGAGTACCTTGTTGAACTAAACATGCGGTTCAGCAAACTTCATAAGCTGTGGGAAGGAAACCGGCCGCTTGCAAACCTTAACTGGATGTATTTGAATCATTCGAAAATCCTAAAGGAGCTACCTGATCTCTCAACAGCCACGAACCTTCAAGAACTATTTCTCGTTAAATGCTCAAGTTTGGTGGAGCTCCCATCCTCTATCGGAAAAGCCACTAATCTCCAGAAACTGTATCTTAATATGTGCACGAGTTTGGTGGAGCTGCCCTCTTCTATTGGGAACCTTCATAAGTTACAAAAATTGACTTTGAATGGATGCTCAAAGCTAGAGGTTCTTCCAGCTAACATCAACTTGGAATCTCTTGATGAACTTGATCTCACTGATTGCTTGGTGTTGAAAAGATTTCCTGAGATCTCTACAAACATTAAAGTTCTCAAGCTCTTAAGAACTACAATAAAAGAAGTCCCTTCGTCAATTAAGTCATGGCCTCGTCTTCGCGATTTGGAATTGTCATACAATCAAAACCTCAAAGGATTCATGCATGCTCTTGATATCATCACGACGATGTACTTTAACGATATAGAAATGCAAGAAATTCCTTTGTGGGTCAAGAAAATCTCTAGGCTTCAGACACTTATACTCAACGGATGTAAGAAGCTGGTATCACTCCCACAGCTTCCGGATTCCTTATCATACCTAAAGGTAGTAAACTGTGAGTCACTGGAGAGACTTGATTGCTCATTTCATAATCCAAAGATGTCTCTTGGGTTTATTAACTGCCTCAAACTGAATAAAGAAGCAAAGGAACTCATCATCCAGATTACAACAAAGTGTACAGTCTTACCCGGTAGAGAGGTGCCAGTGTACTTCACTCATCGAACTAAAAATGGAAGTTCCTTGAGAGTAAATTTGAATCGAAGGCCTCTTTCTACAGCCTCGAGATTTAAGGCTTGCATCTTGCTGGTTAATAAATATTGCAAGGAGAATGAGGTGAAAGAGGTGTTTGGTAGAAAAATGATGAAGGCATCTTACTGCATCATAGATCTTGGTCTTGATGTTCAGTGCAGACCTACACACCACTTTCTACCTCCCTCTTTAACTGAGCATTTGTACATCTTTGACTTTGAAGCAGATGTGACATCCAACGAGCTTTTCTGTGACTTCCAAGTCGACAGTAACGAAATGGTTATAAAAGAATGTGGGATAATCCAACTTTAA


Protein sequences

Name Description Sequence
00931 NB-ARC domains and 5 PF|00560 Leucine Rich Repeats. 00931 NB-ARC domains and 5 PF|00560 Leucine Rich Repeats.

MTSMIASRQQSQRSCPICATPFPSSSSSHKWTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCTVLPGREVPVYFTHRTKNGSSLRVNLNRRPLSTASRFKACILLVNKYCKENEVKEVFGRKMMKASYCIIDLGLDVQCRPTHHFLPPSLTEHLYIFDFEADVTSNELFCDFQVDSNEMVIKECGIIQL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
21-172 TIR
Toll-Interleukin receptor

PFPSSSSSHKWTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGY

Gene3D: G3DSA:3.40.50.10140
29-166 G3DSA:3.40.50.10140

HKWTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKM

ProfileScan: PS50104
IPR000157
31-169 TIR
Toll-Interleukin receptor

WTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTT

HMMSmart: SM00255
IPR000157
32-169 TIR
Toll-Interleukin receptor

THQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTT

HMMPfam: PF01582
IPR000157
35-164 TIR
Toll-Interleukin receptor

VFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALA

HMMPanther: PTHR11017:SF20
56-1036 PTHR11017:SF20,SUBFAMILY NOT NAMED

FQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCTVLPGREVPVYFTHRTKNGSSLRVNLNRRPLSTASRFKACILLVNKYCKENEVKEVFGRKMMKASYCIIDLGLDVQCRPTHHFLPPSLTEHLYIFDFEADVTSNELFCDFQVDSNEMVIKECGIIQL

HMMPanther: PTHR11017
56-1036 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FQRKGITPFIDNEIKRGESIGLEIIHAIRESKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCTVLPGREVPVYFTHRTKNGSSLRVNLNRRPLSTASRFKACILLVNKYCKENEVKEVFGRKMMKASYCIIDLGLDVQCRPTHHFLPPSLTEHLYIFDFEADVTSNELFCDFQVDSNEMVIKECGIIQL

superfamily: SSF52540
86-461 SSF52540

SKIAIVLLSRNYASSSWCLDELVEIMKCKEEFSQIVIPIFYRVDPSDVKKLTGNFGNVFKNNCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDNEATMIENIATDISNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFL

Gene3D: G3DSA:3.40.50.300
192-237 G3DSA:3.40.50.300

SNMLNYSTPSRDFDGLIGMRAHMKVMEPMLCLHSDEVRMIGIWGPS

HMMPfam: PF00931
IPR002182
220-475 NB-ARC,NBS
NB-ARC

MLCLHSDEVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFPSAYEACQIFCMYAFGQKFPKDGFEELAWEVAKLLGGLPLGLRVMGSHFRGMSKHEWINALPRLRTRLDANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKV

HMMSmart: SM00382
IPR003593
227-370 AAA,NBS
ATPase, AAA+ type, core

EVRMIGIWGPSGIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLLKAHDGINHIYNVNFP

FPrintScan: PR00364
IPR000767
230-245 DISEASERSIST
Disease resistance protein

MIGIWGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
238-355 G3DSA:3.40.50.300

GIGKTTIARILFSQFSDSFELSVFMENVKELMYTRPVCSDEYSAKLHLQKQFMSQIINHKDIEIPHLGVVEDRLKDKKVFIVLDNIDQSIQLDAIAKESRWFGHGSRIIITTQDRKLL

FPrintScan: PR00364
IPR000767
310-324 DISEASERSIST
Disease resistance protein

RLKDKKVFIVLDNID

FPrintScan: PR00364
IPR000767
404-418 DISEASERSIST
Disease resistance protein

LGGLPLGLRVMGSHF

superfamily: SSF46785
439-549 SSF46785

ANIQSILKFSYNALCEEDKDLFLYIACLFNNKRIEKVEEHLAEKSLNVKQGLHVLTEKSLISIEGGRIKMHNLLEQLGKEIVRHGLGHQPIREPGKRQFLVDTRDICELLT

superfamily: SSF52058
523-910 SSF52058,LRR

GLGHQPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYYRYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCESLERLDCSFHNPKMSLGFINCLKLNKEAKELIIQITTKCT

Gene3D: G3DSA:3.80.10.10
615-870 G3DSA:3.80.10.10

ILEWDHFPLTCMPSNFCTEYLVELNMRFSKLHKLWEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVNCE

HMMPfam: PF07725
IPR011713
634-652 LRR_3
Leucine-rich repeat 3

YLVELNMRFSKLHKLWEGN

FPrintScan: PR00364
IPR000767
724-740 DISEASERSIST
Disease resistance protein

GNLHKLQKLTLNGCSKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox