PRGDB00061808 (Contains similarity to gb|AF074916 NBS/LRR disease resistance protein from Arabidopsis thaliana and contains a PF|00931 NB-ARC domain.)

From PRG Wiki
Jump to: navigation, search

AF074916 NBS/LRR disease resistance protein from Arabidopsis thaliana and contains a PF|00931 NB-ARC domain.|{| style="width: 30em; font-size: 90%; border: 1px solid #aaaaaa; background-color: #f9f9f9; color: black; margin-bottom: 0.5em; margin-left: 1em; padding: 0.2em; float: right; clear: right; text-align:left;" ! style="text-align: center; background-color:#ccccff;" colspan="2" |Contains similarity to gb|AF074916 NBS/LRR disease resistance protein from Arabidopsis thaliana and contains a PF|00931 NB-ARC domain.

|- ! Gene Type | Putative_R-Genes,_collected_from_NCBI_Protein |- ! GenBank | 5881519 (AC008016) |- ! Gene Class | NL |- ! Domain Type | NBS, LRR, Others

|- ! Gene Species | Arabidopsis thaliana |- ! |

Comment?

|}Arabidopsis thaliana chromosome 1 BAC F6D8 sequence, complete sequence.

DNA Sequence

TGAAAGCTGGAGTTCCGCCACCGGATGCGCAGAACCGGTCGAAGATAGTGTTCACGACATGTTCCGAAGAAGTTTGTAAGGAGATGAGTGCACAGACAAAGATCAAAGTAGAGAAATTGGCATGGGAACGAGCTTGGGACTTGTTTAAGAAGAATGTTGGAGAAGATACTATAAAGAGCCACCCAGACATAGCCAAAGTGGCTCAAGAGGTTGCAGCCAGGTGCGACGGTCTTCCTCTAGCTTTGGTCACCATTGGCCGAGCCATGGCCTCCAAGAAAACCCCTCAAGAATGGCGTGACGCCTTGTACATCTTGAGTAACTCTCCTCCTAATTTCTCAGGTCAAATTTCTTAAATGGGAAAAGATTTCAAGAGTTTGGTTACTAGATGCATCTATGTTGGGAAGATGAATGATAATGCAAAGAAGCTGAAAATCGCGACGGAGGAGCTCAAAGATCTTGGAAACAACGTGATGAAAAGAGTCAAGCTTTGTGAGGAGCAGCAACAGATGAAGCGGCTTGACAAAGTCCAAACATGGCTAAGACAAGCCGACACTGTTATTAAAGAAGCTGAGGAGTATTTCTTGATGTCTTCTTCGTCTTCTTCTTCTGGTTTGATATCGTCGAGCCACAAGATGGAGAAGAAGATTTGCAAGAAGCTGAAAGAGGTTCAGGAGATTAAGAGCAGAGGAATGTTTGAAGTTGTTGCTGAGAGCACTGGAGGCATTGGAGGAGGGGCGGGCGGCGGATTGACGATTAAGGATAGCGATGAGCAGACGATTGGGTTAGAGGCGGTTTCGGGTTTGGTTTGGAGGTGTTTGACGATGGAGAACACTGGTATTATTGGATTATATGGTGTGGAAGGTGTTGGAAAGACGACTGTTTTGACTCAGGTTAATAACAGGTTGCTTCAACAGAAAGCAAATGGGTTTGATTTTGTTTTGTGGGTGTTTGTGTCCAAGAACCTGAATCTTCAGAAGATTCAAGATACGATTAGGGAGAAGATTGGGTTCTTGGATAGGACTTGGACGAGTAAGTCCGAGGAAGAGAAAGCTGCGAAGATCTTTGAGATCTTGAGTAAGAGACGGTTCGCTTTGTTTCTTGATGATGTTTGGGAGAAAGTTGATCTTG


Protein sequences

Name Description Sequence
00931 NB-ARC domain. 00931 NB-ARC domain.

MGKDFKSLVTRCIYVGKMNDNAKKLKIATEELKDLGNNVMKRVKLCEEQQQMKRLDKVQTWLRQADTVIKEAEEYFLMSSSSSSSGLISSSHKMEKKICKKLKEVQEIKSRGMFEVVAESTGGIGGGAGGGLTIKDSDEQTIGLEAVSGLVWRCLTMENTGIIGLYGVEGVGKTTVLTQVNNRLLQQKANGFDFVLWVFVSKNLNLQKIQDTIREKIGFLDRTWTSKSEEEKAAKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPDAQNRSKIVFTTCSEEVCKEMSAQTKIKVEKLAWERAWDLFKKNVGEDTIKSHPDIAKVAQEVAARCDGLPLALVTIGRAMASKKTPQEWRDALYILSNSPPNFSGQIS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
1-270 PTHR23155:SF108,SUBFAMILY NOT NAMED

MGKDFKSLVTRCIYVGKMNDNAKKLKIATEELKDLGNNVMKRVKLCEEQQQMKRLDKVQTWLRQADTVIKEAEEYFLMSSSSSSSGLISSSHKMEKKICKKLKEVQEIKSRGMFEVVAESTGGIGGGAGGGLTIKDSDEQTIGLEAVSGLVWRCLTMENTGIIGLYGVEGVGKTTVLTQVNNRLLQQKANGFDFVLWVFVSKNLNLQKIQDTIREKIGFLDRTWTSKSEEEKAAKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPDAQN

HMMPanther: PTHR23155
1-270 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MGKDFKSLVTRCIYVGKMNDNAKKLKIATEELKDLGNNVMKRVKLCEEQQQMKRLDKVQTWLRQADTVIKEAEEYFLMSSSSSSSGLISSSHKMEKKICKKLKEVQEIKSRGMFEVVAESTGGIGGGAGGGLTIKDSDEQTIGLEAVSGLVWRCLTMENTGIIGLYGVEGVGKTTVLTQVNNRLLQQKANGFDFVLWVFVSKNLNLQKIQDTIREKIGFLDRTWTSKSEEEKAAKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPDAQN

superfamily: SSF52540
144-357 SSF52540

LEAVSGLVWRCLTMENTGIIGLYGVEGVGKTTVLTQVNNRLLQQKANGFDFVLWVFVSKNLNLQKIQDTIREKIGFLDRTWTSKSEEEKAAKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPDAQNRSKIVFTTCSEEVCKEMSAQTKIKVEKLAWERAWDLFKKNVGEDTIKSHPDIAKVAQEVAARCDGLPLALVTIGRAMASKKTPQEWR

HMMPfam: PF00931
IPR002182
154-370 NB-ARC,NBS
NB-ARC

CLTMENTGIIGLYGVEGVGKTTVLTQVNNRLLQQKANGFDFVLWVFVSKNLNLQKIQDTIREKIGFLDRTWTSKSEEEKAAKIFEILSKRRFALFLDDVWEKVDLVKAGVPPPDAQNRSKIVFTTCSEEVCKEMSAQTKIKVEKLAWERAWDLFKKNVGEDTIKSHPDIAKVAQEVAARCDGLPLALVTIGRAMASKKTPQEWRDALYILSNSPPNF

Gene3D: G3DSA:3.40.50.300
162-252 G3DSA:3.40.50.300

IIGLYGVEGVGKTTVLTQVNNRLLQQKANGFDFVLWVFVSKNLNLQKIQDTIREKIGFLDRTWTSKSEEEKAAKIFEILSKRRFALFLDDV

FPrintScan: PR00364
IPR000767
162-177 DISEASERSIST
Disease resistance protein

IIGLYGVEGVGKTTVL

FPrintScan: PR00364
IPR000767
239-253 DISEASERSIST
Disease resistance protein

ILSKRRFALFLDDVW

FPrintScan: PR00364
IPR000767
333-347 DISEASERSIST
Disease resistance protein

CDGLPLALVTIGRAM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox