PRGDB00061816 (NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 320154495 (GU258501)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza barthii

Comment?

Oryza barthii seed accession number 100931 NBS-LRR disease resistance protein (Pikh) gene, complete cds.

DNA Sequence

AACTTGTCATCATTCAGTGCCCAAAATTGAGAGCACTGCATATGGAGTTTCCATCGATTGAAAAATTGATTTTGTGGATGAATAACAAGATGTTGTACAGCTCAAAGGAAGGTCTGAGAGGTGTAGAGAAGAGCCTCGAAAATCTTTCAATTTCTTTCTGTGAAGAGTTGCATGCTTCTTCAGGCTGTGAGGGTCTACAGGCTCTTGATCGCCTCAAGAAGTTGGAGATATGTGGTTGTCATGAATTGTCATGCCTCCCACAGGGTTTGCAGCATCTTTCCTCTCTCACCAGCTTGAAAATTGATAACTGCAACAAATTGGAGATTTTGCCAGAATGGTTGGAGAACCTACCTTTTCTACAGATAATGTGTTTGTCTGGCTGTCCAATTCTGCACTCCATTCCTGAAGGCCTGACATGTAGCGACATTATTGTTGAAGATTGCCCCAATTTTAAAGAACCATCAGGTAAATCATCAGTGCTCTGTTCATGGAAAGCCATGTTTCTGATTTTCATTGAGCTATTCTTAAAGCAATTGAACTAGATGAGTAAAATGAAGAAGCTTCAGTACCTAAATATTCTCAATTGCTACTCACTCACAGCAATGCCTCATGCAATGGGCCAACTTATAAATCTTCACACATTGCTTGGTTACTTTGTCCCCAACAATGGAAGTAGTGCGATGTCAGAGCTTCAATCACTGCCAGACCTCAATAGACTATCACTAGTGAACCTTGAAAAGGTTTCAGACACTGAAGATGCAAGAATGGCAAAACTTCAAGAGAAAGAAAAGCTCGAGACATTGATGTTGAGGTGGAATATGGATGCTGTAAATGCCAGTAGAATAGATTATGAAGTACTTGAAACCCTCCAACCTAGCCAGTGCCTGAAAACTTTGGAGATTGTTGCGTATGAAGGACATGTATTTCCATCTTGGATAACAAGCACTGAGCCATATCTCACATCTCTGGTTGAGATAAGGCTGGTTAATCTGAGATCATGTGAAAATGCTTTACCTCCACTTGGGCTACTGCCATGTCTGAAGATTGTGGAGATAAGCCGAGTTGATAATATCAGTTGTATTGACGATAATTTCTATGGTCACAACG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Oryza barthii].

MSKMKKLQYLNILNCYSLTAMPHAMGQLINLHTLLGYFVPNNGSSAMSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAVNASRIDYEVLETLQPSQCLKTLEIVAYEGHVFPSWITSTEPYLTSLVEIRLVNLRSCENALPPLGLLPCLKIVEISRVDNISCIDDNFYGHNELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSIPEGLTCSDIIVEDCPNFKEPSGKSSVLCSWKAMFLIFIELFLKQLN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-360 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MSKMKKLQYLNILNCYSLTAMPHAMGQLINLHTLLGYFVPNNGSSAMSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAVNASRIDYEVLETLQPSQCLKTLEIVAYEGHVFPSWITSTEPYLTSLVEIRLVNLRSCENALPPLGLLPCLKIVEISRVDNISCIDDNFYGHNELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSIPEGLTCSDIIVEDCPNFKEPSGKSSVLCSWKAMFLIFI

HMMPanther: PTHR23155:SF216
1-360 PTHR23155:SF216,OS11G0640600 PROTEIN

MSKMKKLQYLNILNCYSLTAMPHAMGQLINLHTLLGYFVPNNGSSAMSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAVNASRIDYEVLETLQPSQCLKTLEIVAYEGHVFPSWITSTEPYLTSLVEIRLVNLRSCENALPPLGLLPCLKIVEISRVDNISCIDDNFYGHNELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSIPEGLTCSDIIVEDCPNFKEPSGKSSVLCSWKAMFLIFI

Gene3D: G3DSA:3.80.10.10
2-120 G3DSA:3.80.10.10

SKMKKLQYLNILNCYSLTAMPHAMGQLINLHTLLGYFVPNNGSSAMSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAVNASRIDYEVLETLQPSQCLKTLEI

superfamily: SSF52058
4-323 SSF52058,LRR

MKKLQYLNILNCYSLTAMPHAMGQLINLHTLLGYFVPNNGSSAMSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAVNASRIDYEVLETLQPSQCLKTLEIVAYEGHVFPSWITSTEPYLTSLVEIRLVNLRSCENALPPLGLLPCLKIVEISRVDNISCIDDNFYGHNELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSIP

Gene3D: G3DSA:3.80.10.10
142-153 G3DSA:3.80.10.10

LVEIRLVNLRSC

Gene3D: G3DSA:3.80.10.10
192-325 G3DSA:3.80.10.10

IIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSIPEG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox