PRGDB00061819 (verticillium wilt disease resistance protein Ve2)

From PRG Wiki
Jump to: navigation, search
verticillium wilt disease resistance protein Ve2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 239580124 (FJ985981)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum lycopersicum

Comment?

Solanum lycopersicum cultivar Peto 95-43 verticillium wilt disease resistance protein Ve2 (Ve2) gene, partial cds.

DNA Sequence

TCCTAGTCTTGCGCTCCAATAAATTCAATGGAAATCTTACGTGTAATATAACCAAACATAGCTGGAAGAATCTCCAGATCATAGATATAGCTTCCAACAATTTTACTGGTATGTTGAATGCAGAATGCTTTACAAATTGGAGAGGAATGATGGTTGCAAAAGATTACGTGGAGACAGGACGCAATCATATCCAGTATGAGTTCTTACAACTAAGTAACTTGTACTATCAGGATACAGTGACATTAATCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTTAGGGTCTTCACATCTATTGATTTCTCTTCCAATAGATTTCAAGGAAAGATACCAGATACTGTTGGGGATCTTAGCTCACTTTATGTTTTGAACCTGTCACACAATGCCCTCGAGGGACCAATTCCAAAATCAATTGGGAAGCTACAAATGCTTGAATCACTAGACCTGTCAACAAACCACCTGTCCGGGGAGATCCCCTCAGAGCTTTCAAGTCTCACATTCTTAGCAGTTTTGAACTTATCGTTCAACAATTTGTTTGGAAAAATCCCGCAAAGTAATCAATTTGAAACATTCCCAGCAGAATCCTTTGAAGGAAACAGAGGCCTATGCGGGCTTCCTCTTAACGTCATTTGCAAAAGCGATACTTCAGAGTTGAAACCAGCACCAAGTTCTCAAGATGACTCTTATGATTGGCAGTTCATATTTACGGGTGTGGGATATGGAGTAGGGGCAGCAATCTCCATTGCACCTCTGTTGTTTTACAAGCAAGGAAACAAATACTTTGACAAACATTTGGAGAGAATGCTTAAACTGATGTTTCCTAGATACTGGTTCAGTTACACCAGATTTGACCCTGGGAAGGTTGTGGCTGTGGAACACTATGAAGATGAGACCCCAGATGACACCGAAGATGACGATGAGGGTGGAAAAGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein Ve2 verticillium wilt disease resistance protein Ve2 [Solanum lycopersicum].

LVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPLNVICKSDTSELKPAPSSQDDSYDWQFIFTGVGYGVGAAISIAPLLFYKQGNKYFDKHLERMLKLMFPRYWFSYTRFDPGKVVAVEHYEDETPDDTEDDDEGGK

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-212 SSF52058,LRR

LVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPLNVIC

HMMPanther: PTHR24420
1-249 PTHR24420,FAMILY NOT NAMED

LVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPLNVICKSDTSELKPAPSSQDDSYDWQFIFTGVGYGVGAAISI

HMMPanther: PTHR24420:SF908
1-249 PTHR24420:SF908

LVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPLNVICKSDTSELKPAPSSQDDSYDWQFIFTGVGYGVGAAISI

Gene3D: G3DSA:3.80.10.10
2-51 G3DSA:3.80.10.10

VLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMV

HMMPfam: PF13855
99-155 LRR_8,Leucine rich repeat

SIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHL

Gene3D: G3DSA:3.80.10.10
100-208 G3DSA:3.80.10.10

IDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPL

FPrintScan: PR00019
145-158 LEURICHRPT,Leucine-rich repeat signature

LESLDLSTNHLSGE

FPrintScan: PR00019
166-179 LEURICHRPT,Leucine-rich repeat signature

LTFLAVLNLSFNNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox