PRGDB00061820 (verticillium wilt disease resistance protein Ve2)

From PRG Wiki
Jump to: navigation, search
verticillium wilt disease resistance protein Ve2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 239580122 (FJ985980)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum lycopersicum

Comment?

Solanum lycopersicum cultivar Bush Celebrity verticillium wilt disease resistance protein Ve2 (Ve2) gene, partial cds.

DNA Sequence

TCCTAGTCTTGCGCTCCAATAAATTCAATGGAAATCTTACGTGTAATATAACCAAACATAGCTGGAAGAATCTCCAGATCATAGATATAGCTTCCAACAATTTTACTGGTATGTTGAATGCAGAATGCTTTACAAATTGGAGAGGAATGATGGTTGCAAAAGATTACGTGGAGACAGGACGCAATCATATCCAGTATGAGTTCTTACAACTAAGTAACTTGTACTATCAGGATACAGTGACATTAATCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTTAGGGTCTTCACATCTATTGATTTCTCTTCCAATAGATTTCAAGGAAAGATACCAGATACTGTTGGGGATCTTAGCTCACTTTATGTTTTGAACCTGTCACACAATGCCCTCGAGGGACCAATTCCAAAATCAATTGGGAAGCTACAAATGCTTGAATCACTAGACCTGTCAACAAACCACCTGTCCGGGGAGATCCCCTCAGAGCTTTCAAGTCTCACATTCTTAGCAGTTTTGAACTTATCGTTCAACAATTTGTTTGGAAAAATCCCGCAAAGTAATCAATTTGAAACATTCCCAGCAGAATCCTTTGAAGGAAACAGAGGCCTATGCGGGCTTCCTCTTAACGTCATTTGCAAAAGCGATACTTCAGAGTTGAAACCAGCACCAAGTTCTCAAGATGACTCTTATGATTGGCAGTTCATATTTACGGGTGTGGGATATGGAGTAGGGGCAGCAATCTCCATTGCACCTCTGTTGTTTTACAAGCAAGGAAACAAATACTTTGACAAACATTTGGAGAGAATGCTTAAACTGATGTTTCCTAGATACTGGTTCAGTTACACCAGATTTGACCCTGGGAAGGTTGTGGCTGTGGAACACTATGAAGATGAGACCCCAGATGACACCGAAGATGACGATGAGGGTGGAAAAGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein Ve2 verticillium wilt disease resistance protein Ve2 [Solanum lycopersicum].

LVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPLNVICKSDTSELKPAPSSQDDSYDWQFIFTGVGYGVGAAISIAPLLFYKQGNKYFDKHLERMLKLMFPRYWFSYTRFDPGKVVAVEHYEDETPDDTEDDDEGGK

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-212 SSF52058,LRR

LVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPLNVIC

HMMPanther: PTHR24420
1-249 PTHR24420,FAMILY NOT NAMED

LVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPLNVICKSDTSELKPAPSSQDDSYDWQFIFTGVGYGVGAAISI

HMMPanther: PTHR24420:SF908
1-249 PTHR24420:SF908

LVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPLNVICKSDTSELKPAPSSQDDSYDWQFIFTGVGYGVGAAISI

Gene3D: G3DSA:3.80.10.10
2-51 G3DSA:3.80.10.10

VLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMV

HMMPfam: PF13855
99-155 LRR_8,Leucine rich repeat

SIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHL

Gene3D: G3DSA:3.80.10.10
100-208 G3DSA:3.80.10.10

IDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFPAESFEGNRGLCGLPL

FPrintScan: PR00019
145-158 LEURICHRPT,Leucine-rich repeat signature

LESLDLSTNHLSGE

FPrintScan: PR00019
166-179 LEURICHRPT,Leucine-rich repeat signature

LTFLAVLNLSFNNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox