PRGDB00061829 (Cf2/Cf5-like disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Cf2/Cf5-like disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 253721990 (EU358770)
Gene Class Unknown
Domain Type LRR
Gene Species Aegilops tauschii

Comment?

Aegilops tauschii chromosome 1D clone BAC RI101M03 map 1DL, *** SEQUENCING IN PROGRESS ***, 11 ordered pieces.

DNA Sequence

TTACCGGGAACACTGAAAAATATGTGTAATTTAAGGTCTCTAGATTTCAGCAACAACTACATCAGCGGGGACATAACAGAGGTGATTGACAGGTTACCCAATTGTTCTTGGAATAATTTGCAAGAGCTGTTTTTGGTCGGTGCCAACCTCACTGGCACGACTTTACCATTCGTGTCAACCCTTACTAGCTTAAGCATGCTTGATGTCACTGGCAATCAGTTGAGCGGTTCAGTGCTTGTGGATATTAGCAGACTTACGAATTTGACTTACTTACACCTTGATGAAAACAACTTGAACGGTCCGGTGCCCATGGAGATTGGCGCGCTTACAAGCTTGACTGACTTAGACCTTGGAAACAACAATTTGAGTGGTTCACTGCCCGTAGAGATTAGTGCGCTTACAAAGTTGACTACATTAGCTCTTCAAAACAACAACTTGAGTGGTGTGATATCAGAAGGTCATTTTGCTGGTTTGGTGAATTTAAAGTTCATCTACTTATTTAATAATAAGGTGGAACTCATTATGGACTCGCATTGGGTGCCTCCGTTCAACTTGGATACAGCATGGCTTTCATCTTGTAATTTGGGTCCCGGGTTTCCTGAATGGTTTCGATGGCAAAATAGCACCAGTGACCTTAAAATTTCAAACACGGGTCTAGTTGGTAGGATCCCAGATTGGTTTTGGGAAACCTTTTCTCAAGCTACACATTTGGACTTATCCTCAAACCAACTTAGCGGTGAGTTACCATTAAGTATGGAGTTCATGTCTGTGATTGCGCTTTCAATGCAGTCAAATCAACTGACTGGTTTGATACCCAAGTTACCAAGAACAATTGAGTTATTGGACATATCAAGAAACTCTTTAGATGGGTTTGTGCCAAATTTCCAAGCTCCACATTTGGAGGTTGCAGTTCTGTTTTCCAATTCTATAACCGGGACTATTCCAACGTCAATTTGTCGACTGCAAAAACTGCGGGTCTTGGATCTTTCGAACAATATGCTTTCAAAAGAACTTCCTGATTGTGGCCAAAAAGAGTTGAAACCACAGAACCAATCTAGCAACAACTCTACAGGAGTCAATTCATTAAGTTCTTTCAGCTTGAAAATCACCACTCTTCTTCTAAGCAACAACAGTTTTTCAGGTGGATTTCCTTTGTTCCTACAACAATGTCAGAATCTTAGTTTCCTCGATCTAAGTCAAAACAAATTCACTGGAGAGTTACCTAGATGGATTAGTAAATCCATGCCTGGTTTGGTTATCCTACGATTAAGATCAAACAACTTTTTTGGTCAAATCCCAAATGAAATAATGGGACTTCAGGATGTTCGTATTCTAGATCTATCTAATAATAACTTTTCCGGGGCCATACCACCGTATATGGAAAACTTGAAAGCTTTGACTGGCACTGCTGCTACAGATGATTATACACCATTAGATGATCCTTTCGCTGAAGAGTACAGTGACAAGTATGGTTTGACTGATATGGGAATGTCTAATGATAGCTTGTCAGTGGTGATAAAAGGGCAAGTGCTTGAATACACAAAGAATGCTCTATATTTGATGAGCATTGATTTATCTTGCAACAGTTTGACTGGAGAAATCCCAGTGAAACTAAGCGCCCTTGCTGGTCTCATAAATTTGAATTTATCATCAAACATGTTGAGTGGAAATATCCCATATAAGATTGGCAACCTTCGATTGTTGGAGTCTCTTGACCTGTCAAAGAACATACTTGGTGGGCAAATTCCCCGGAGCTTATCAGATTTGACATACCTGAGCCGTCTGAACTTGTCGTACAACAATCTATCGGGAAGGATACCCTCAGGGCATCAACTCAACATCCTCGGTACAGATGATGCAGCCTATATGTACATTGGTAATCCTGGTCTTTGTGGACATCCAGTTCTAAGGCAATGTCCTGGTCCGCCTAGAGATCCGCCAACCAATGGAGAACCAACAAGGTTGCCTGAAGATGGCTTGTCTCAAATAGATTTTCTTCTTGGATCAATTATTGGCTTTGTGGCGGGCACCTGGATGGTGTTTTTTGGACTTCTCTTCATGAAGAGATGGAGTTATGCTTATTTCGGGCTACTCGACAAGCTATATGACAGGTTGTATGTCATCTCTGTTGTTACTTGGCAAAAATGGTTCGGACCACAGGTGTGA


Protein sequences

Name Description Sequence
Cf2/Cf5-like disease resistance protein Cf2/Cf5-like disease resistance protein [Aegilops tauschii].

LPGTLKNMCNLRSLDFSNNYISGDITEVIDRLPNCSWNNLQELFLVGANLTGTTLPFVSTLTSLSMLDVTGNQLSGSVLVDISRLTNLTYLHLDENNLNGPVPMEIGALTSLTDLDLGNNNLSGSLPVEISALTKLTTLALQNNNLSGVISEGHFAGLVNLKFIYLFNNKVELIMDSHWVPPFNLDTAWLSSCNLGPGFPEWFRWQNSTSDLKISNTGLVGRIPDWFWETFSQATHLDLSSNQLSGELPLSMEFMSVIALSMQSNQLTGLIPKLPRTIELLDISRNSLDGFVPNFQAPHLEVAVLFSNSITGTIPTSICRLQKLRVLDLSNNMLSKELPDCGQKELKPQNQSSNNSTGVNSLSSFSLKITTLLLSNNSFSGGFPLFLQQCQNLSFLDLSQNKFTGELPRWISKSMPGLVILRLRSNNFFGQIPNEIMGLQDVRILDLSNNNFSGAIPPYMENLKALTGTAATDDYTPLDDPFAEEYSDKYGLTDMGMSNDSLSVVIKGQVLEYTKNALYLMSIDLSCNSLTGEIPVKLSALAGLINLNLSSNMLSGNIPYKIGNLRLLESLDLSKNILGGQIPRSLSDLTYLSRLNLSYNNLSGRIPSGHQLNILGTDDAAYMYIGNPGLCGHPVLRQCPGPPRDPPTNGEPTRLPEDGLSQIDFLLGSIIGFVAGTWMVFFGLLFMKRWSYAYFGLLDKLYDRLYVISVVTWQKWFGPQV


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
2-34 G3DSA:3.80.10.10

PGTLKNMCNLRSLDFSNNYISGDITEVIDRLPN

superfamily: SSF52058
2-290 SSF52058,LRR

PGTLKNMCNLRSLDFSNNYISGDITEVIDRLPNCSWNNLQELFLVGANLTGTTLPFVSTLTSLSMLDVTGNQLSGSVLVDISRLTNLTYLHLDENNLNGPVPMEIGALTSLTDLDLGNNNLSGSLPVEISALTKLTTLALQNNNLSGVISEGHFAGLVNLKFIYLFNNKVELIMDSHWVPPFNLDTAWLSSCNLGPGFPEWFRWQNSTSDLKISNTGLVGRIPDWFWETFSQATHLDLSSNQLSGELPLSMEFMSVIALSMQSNQLTGLIPKLPRTIELLDISRNSLDG

HMMPfam: PF13516
8-26 LRR_6,Leucine Rich repeat

MCNLRSLDFSNNYISGDIT

Gene3D: G3DSA:3.80.10.10
38-282 G3DSA:3.80.10.10

NNLQELFLVGANLTGTTLPFVSTLTSLSMLDVTGNQLSGSVLVDISRLTNLTYLHLDENNLNGPVPMEIGALTSLTDLDLGNNNLSGSLPVEISALTKLTTLALQNNNLSGVISEGHFAGLVNLKFIYLFNNKVELIMDSHWVPPFNLDTAWLSSCNLGPGFPEWFRWQNSTSDLKISNTGLVGRIPDWFWETFSQATHLDLSSNQLSGELPLSMEFMSVIALSMQSNQLTGLIPKLPRTIELLD

HMMPanther: PTHR26393:SF516
73-718 PTHR26393:SF516

QLSGSVLVDISRLTNLTYLHLDENNLNGPVPMEIGALTSLTDLDLGNNNLSGSLPVEISALTKLTTLALQNNNLSGVISEGHFAGLVNLKFIYLFNNKVELIMDSHWVPPFNLDTAWLSSCNLGPGFPEWFRWQNSTSDLKISNTGLVGRIPDWFWETFSQATHLDLSSNQLSGELPLSMEFMSVIALSMQSNQLTGLIPKLPRTIELLDISRNSLDGFVPNFQAPHLEVAVLFSNSITGTIPTSICRLQKLRVLDLSNNMLSKELPDCGQKELKPQNQSSNNSTGVNSLSSFSLKITTLLLSNNSFSGGFPLFLQQCQNLSFLDLSQNKFTGELPRWISKSMPGLVILRLRSNNFFGQIPNEIMGLQDVRILDLSNNNFSGAIPPYMENLKALTGTAATDDYTPLDDPFAEEYSDKYGLTDMGMSNDSLSVVIKGQVLEYTKNALYLMSIDLSCNSLTGEIPVKLSALAGLINLNLSSNMLSGNIPYKIGNLRLLESLDLSKNILGGQIPRSLSDLTYLSRLNLSYNNLSGRIPSGHQLNILGTDDAAYMYIGNPGLCGHPVLRQCPGPPRDPPTNGEPTRLPEDGLSQIDFLLGSIIGFVAGTWMVFFGLLFMKRWSYAYFGLLDKLYDRLYVISVVTWQKWFG

HMMPanther: PTHR26393
73-718 PTHR26393,FAMILY NOT NAMED

QLSGSVLVDISRLTNLTYLHLDENNLNGPVPMEIGALTSLTDLDLGNNNLSGSLPVEISALTKLTTLALQNNNLSGVISEGHFAGLVNLKFIYLFNNKVELIMDSHWVPPFNLDTAWLSSCNLGPGFPEWFRWQNSTSDLKISNTGLVGRIPDWFWETFSQATHLDLSSNQLSGELPLSMEFMSVIALSMQSNQLTGLIPKLPRTIELLDISRNSLDGFVPNFQAPHLEVAVLFSNSITGTIPTSICRLQKLRVLDLSNNMLSKELPDCGQKELKPQNQSSNNSTGVNSLSSFSLKITTLLLSNNSFSGGFPLFLQQCQNLSFLDLSQNKFTGELPRWISKSMPGLVILRLRSNNFFGQIPNEIMGLQDVRILDLSNNNFSGAIPPYMENLKALTGTAATDDYTPLDDPFAEEYSDKYGLTDMGMSNDSLSVVIKGQVLEYTKNALYLMSIDLSCNSLTGEIPVKLSALAGLINLNLSSNMLSGNIPYKIGNLRLLESLDLSKNILGGQIPRSLSDLTYLSRLNLSYNNLSGRIPSGHQLNILGTDDAAYMYIGNPGLCGHPVLRQCPGPPRDPPTNGEPTRLPEDGLSQIDFLLGSIIGFVAGTWMVFFGLLFMKRWSYAYFGLLDKLYDRLYVISVVTWQKWFG

HMMPfam: PF13855
110-170 LRR_8,Leucine rich repeat

TSLTDLDLGNNNLSGSLPVEISALTKLTTLALQNNNLSGVISEGHFAGLVNLKFIYLFNNK

FPrintScan: PR00019
112-125 LEURICHRPT,Leucine-rich repeat signature

LTDLDLGNNNLSGS

HMMPfam: PF00560
IPR001611
235-251 LRR_1
Leucine-rich repeat

THLDLSSNQLSGELPLS

superfamily: SSF52058
251-639 SSF52058,LRR

SMEFMSVIALSMQSNQLTGLIPKLPRTIELLDISRNSLDGFVPNFQAPHLEVAVLFSNSITGTIPTSICRLQKLRVLDLSNNMLSKELPDCGQKELKPQNQSSNNSTGVNSLSSFSLKITTLLLSNNSFSGGFPLFLQQCQNLSFLDLSQNKFTGELPRWISKSMPGLVILRLRSNNFFGQIPNEIMGLQDVRILDLSNNNFSGAIPPYMENLKALTGTAATDDYTPLDDPFAEEYSDKYGLTDMGMSNDSLSVVIKGQVLEYTKNALYLMSIDLSCNSLTGEIPVKLSALAGLINLNLSSNMLSGNIPYKIGNLRLLESLDLSKNILGGQIPRSLSDLTYLSRLNLSYNNLSGRIPSGHQLNILGTDDAAYMYIGNPGLCGHPVLRQC

Gene3D: G3DSA:3.80.10.10
283-468 G3DSA:3.80.10.10

ISRNSLDGFVPNFQAPHLEVAVLFSNSITGTIPTSICRLQKLRVLDLSNNMLSKELPDCGQKELKPQNQSSNNSTGVNSLSSFSLKITTLLLSNNSFSGGFPLFLQQCQNLSFLDLSQNKFTGELPRWISKSMPGLVILRLRSNNFFGQIPNEIMGLQDVRILDLSNNNFSGAIPPYMENLKALTG

FPrintScan: PR00019
321-334 LEURICHRPT,Leucine-rich repeat signature

LQKLRVLDLSNNML

HMMPfam: PF00560
IPR001611
323-341 LRR_1
Leucine-rich repeat

KLRVLDLSNNMLSKELPDC

HMMPfam: PF13516
390-412 LRR_6,Leucine Rich repeat

CQNLSFLDLSQNKFTGELPRWIS

HMMPfam: PF00560
IPR001611
443-463 LRR_1
Leucine-rich repeat

RILDLSNNNFSGAIPPYMENL

Gene3D: G3DSA:3.80.10.10
523-632 G3DSA:3.80.10.10

IDLSCNSLTGEIPVKLSALAGLINLNLSSNMLSGNIPYKIGNLRLLESLDLSKNILGGQIPRSLSDLTYLSRLNLSYNNLSGRIPSGHQLNILGTDDAAYMYIGNPGLCG

HMMPfam: PF13516
568-587 LRR_6,Leucine Rich repeat

LESLDLSKNILGGQIPRSLS

HMMPfam: PF00560
IPR001611
592-608 LRR_1
Leucine-rich repeat

LSRLNLSYNNLSGRIPS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox