PRGDB00061830 (Cf2/Cf5-like disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Cf2/Cf5-like disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 253721990 (EU358770)
Gene Class Unknown
Domain Type LRR
Gene Species Aegilops tauschii

Comment?

Aegilops tauschii chromosome 1D clone BAC RI101M03 map 1DL, *** SEQUENCING IN PROGRESS ***, 11 ordered pieces.

DNA Sequence

AGACACTTAACATTGCAGGAAACAACATCCGAGGAGATGATACCTAGAACAATGCAAAATATGTGTAATCTAAGGTCTCTAGATCTCAGCGTCAACAACATTGACATGGACATAGGAGAGGTAATAGACAGAATACCCAACTGTTGTTGGAAGAATTTACAAGAGCTGAATCTGAGATATGCCAACATCACTGGCATGACATTACAATTTGTGTCAAACCTAACTAGCTTAACCATGCTTCAAGTCAGTCACAACCAATTGAGCGGTTCGGTGCCTCTGGAGATTGGCATGCTTGCAAATTTAACTCACTTGGACCTTGGAAACAACAACTTTAGTGGTGTGATATCAGAAGATCATTTTGCTGGTTTGATGAATTTAAAGTCCATTGACTTATCTCAGAATAATTTGGAACTCATTGTTGATTCGCATTGGGTGCCTCCGTTCAACTTGGATGTGGCATCATTTTCATCTTGTCATTTGGGTCCCCAATTTCCTGAATGGCTTCGATGGCAGAAGAGCATCCGTTCCCTTCAGATTTCAAACAATGGCCTAGTTGGTCGGATCCCAGATTGGTTTTGGACTACCTTTTCTGAAGCTCAGCATTTGGACATCTCCTTCAACCAACTTAGTGGTGACTTACCACTCAATCTGGAGTTCATGTCAATTATTACACTTTCAATGGGGTCAAATCTACTCACTGGTTTGATACCCAAGTTACCAAGAACAGTTGTGGTACTGGACATATCCAATAACTCTTTAAATGGGTTTGTGTCAGATTTCCGAGCTCCACAACTTCAAGTTGCAGTTCTGTATTCCAATTCAATATCCGGGACTATTCCGACGTCAATTTGTCAAATGCGAAAATTGCGGATCTTAAATCTTTCAAACAACCTGCTTTCAAAGGAACTTCCTCACTGTGGCCGAAAAGAGCTGAAACAACAGAACACATCTAGCAGCATCTCTTCCAGTGTCAATTCAATGAGTTCTTTCAGTTTGAATATCACTACTCTTCTCCTAAGTAACAACAGTTTTTCAAGTGGATTTCCTTTGTTCCTACAACAATGTCCAAGCCTTGTTTTCCTGGATCTAACTCAAAACCGATTCAGTGGAGAGTTACCTGGATGGATTGGTGAAGTCATGCCTGGCTTGGTTATCCTACGGTTAAGATCGAACAACTTTTCTGGTCACATTCCAATTGAAATAATGGGACTCCACAATGTTCGTATTCTGGATCTATCCAATAATAACTTCTCGGGGGCCATACCACAATATCTAGAAAATTTGCAAGCTTTGACTAGCACTGCTACTGATTATTATACAAGACATGCTTATCTTTTCTTTGAAGGATACAATGACAAGTATCTAACCTATGATGCAGGACAATCTAATAATAGATTCTCGGTGATGATAAAAGGGCAAGTGCTTGAGTACAGGGAGAATATTGTGTATTTGATGAGCATTGATTTATCTTGCAATAGTTTGACTGGCGAAATCCCAGAGAAACTAAGCTCCCTCGTTGGTCTCATAAGCTTGAATTTATCATCAAACTTGTTGAGTGGAAATATCCCATATAAGATTGGCAAACTTCGATCGCTGGAGTCTCTTGACCTGTCAAAGAACAAACTTGGTGGTGAAATTCCTCAGGGCTTATCAGATTTAACATACCTGATCCGTCTGAACTTGTCATACAACAATCTATCAGGAAGGATACCCTCAGGGCATCAACTCGACACCCTCGAGACAGATGATCCAGCTTCTATGTATATTGGTAATCCTGGTCTTTGTGGGCATCCAGTTCCAAGGGAATGTTTCGGTCCTCCTAGAGATCTGCCCACCAATGGAGCTTCAACAGGATGGGTTGAACATGATTTCTCTCAAACGGATTTTCTTCTAGGATTAATTATCGGTTTTGTGGTGGGCGCTTGGATGGTGTTTTTTGGACTTCTCTTCATAAAGAGATGGAGGTATGCTTATTTTGGGCTACTCGACAACCTATATGACAGGTTGCGTGTCATTTCTGTTGTTACTTGCTAA


Protein sequences

Name Description Sequence
Cf2/Cf5-like disease resistance protein Cf2/Cf5-like disease resistance protein [Aegilops tauschii].

RHLTLQETTSEEMIPRTMQNMCNLRSLDLSVNNIDMDIGEVIDRIPNCCWKNLQELNLRYANITGMTLQFVSNLTSLTMLQVSHNQLSGSVPLEIGMLANLTHLDLGNNNFSGVISEDHFAGLMNLKSIDLSQNNLELIVDSHWVPPFNLDVASFSSCHLGPQFPEWLRWQKSIRSLQISNNGLVGRIPDWFWTTFSEAQHLDISFNQLSGDLPLNLEFMSIITLSMGSNLLTGLIPKLPRTVVVLDISNNSLNGFVSDFRAPQLQVAVLYSNSISGTIPTSICQMRKLRILNLSNNLLSKELPHCGRKELKQQNTSSSISSSVNSMSSFSLNITTLLLSNNSFSSGFPLFLQQCPSLVFLDLTQNRFSGELPGWIGEVMPGLVILRLRSNNFSGHIPIEIMGLHNVRILDLSNNNFSGAIPQYLENLQALTSTATDYYTRHAYLFFEGYNDKYLTYDAGQSNNRFSVMIKGQVLEYRENIVYLMSIDLSCNSLTGEIPEKLSSLVGLISLNLSSNLLSGNIPYKIGKLRSLESLDLSKNKLGGEIPQGLSDLTYLIRLNLSYNNLSGRIPSGHQLDTLETDDPASMYIGNPGLCGHPVPRECFGPPRDLPTNGASTGWVEHDFSQTDFLLGLIIGFVVGAWMVFFGLLFIKRWRYAYFGLLDNLYDRLRVISVVTC


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
3-247 G3DSA:3.80.10.10

LTLQETTSEEMIPRTMQNMCNLRSLDLSVNNIDMDIGEVIDRIPNCCWKNLQELNLRYANITGMTLQFVSNLTSLTMLQVSHNQLSGSVPLEIGMLANLTHLDLGNNNFSGVISEDHFAGLMNLKSIDLSQNNLELIVDSHWVPPFNLDVASFSSCHLGPQFPEWLRWQKSIRSLQISNNGLVGRIPDWFWTTFSEAQHLDISFNQLSGDLPLNLEFMSIITLSMGSNLLTGLIPKLPRTVVVLD

superfamily: SSF52058
12-255 SSF52058,LRR

EMIPRTMQNMCNLRSLDLSVNNIDMDIGEVIDRIPNCCWKNLQELNLRYANITGMTLQFVSNLTSLTMLQVSHNQLSGSVPLEIGMLANLTHLDLGNNNFSGVISEDHFAGLMNLKSIDLSQNNLELIVDSHWVPPFNLDVASFSSCHLGPQFPEWLRWQKSIRSLQISNNGLVGRIPDWFWTTFSEAQHLDISFNQLSGDLPLNLEFMSIITLSMGSNLLTGLIPKLPRTVVVLDISNNSLNG

HMMPfam: PF13516
21-34 LRR_6,Leucine Rich repeat

MCNLRSLDLSVNNI

HMMPanther: PTHR24420
71-655 PTHR24420,FAMILY NOT NAMED

VSNLTSLTMLQVSHNQLSGSVPLEIGMLANLTHLDLGNNNFSGVISEDHFAGLMNLKSIDLSQNNLELIVDSHWVPPFNLDVASFSSCHLGPQFPEWLRWQKSIRSLQISNNGLVGRIPDWFWTTFSEAQHLDISFNQLSGDLPLNLEFMSIITLSMGSNLLTGLIPKLPRTVVVLDISNNSLNGFVSDFRAPQLQVAVLYSNSISGTIPTSICQMRKLRILNLSNNLLSKELPHCGRKELKQQNTSSSISSSVNSMSSFSLNITTLLLSNNSFSSGFPLFLQQCPSLVFLDLTQNRFSGELPGWIGEVMPGLVILRLRSNNFSGHIPIEIMGLHNVRILDLSNNNFSGAIPQYLENLQALTSTATDYYTRHAYLFFEGYNDKYLTYDAGQSNNRFSVMIKGQVLEYRENIVYLMSIDLSCNSLTGEIPEKLSSLVGLISLNLSSNLLSGNIPYKIGKLRSLESLDLSKNKLGGEIPQGLSDLTYLIRLNLSYNNLSGRIPSGHQLDTLETDDPASMYIGNPGLCGHPVPRECFGPPRDLPTNGASTGWVEHDFSQTDFLLGLIIGFVVGAWMVFFGLLFIKRWR

HMMPfam: PF13855
100-139 LRR_8,Leucine rich repeat

NLTHLDLGNNNFSGVISEDHFAGLMNLKSIDLSQNNLELI

FPrintScan: PR00019
101-114 LEURICHRPT,Leucine-rich repeat signature

LTHLDLGNNNFSGV

HMMPfam: PF00560
IPR001611
200-218 LRR_1
Leucine-rich repeat

QHLDISFNQLSGDLPLNLE

superfamily: SSF52058
239-603 SSF52058,LRR

LPRTVVVLDISNNSLNGFVSDFRAPQLQVAVLYSNSISGTIPTSICQMRKLRILNLSNNLLSKELPHCGRKELKQQNTSSSISSSVNSMSSFSLNITTLLLSNNSFSSGFPLFLQQCPSLVFLDLTQNRFSGELPGWIGEVMPGLVILRLRSNNFSGHIPIEIMGLHNVRILDLSNNNFSGAIPQYLENLQALTSTATDYYTRHAYLFFEGYNDKYLTYDAGQSNNRFSVMIKGQVLEYRENIVYLMSIDLSCNSLTGEIPEKLSSLVGLISLNLSSNLLSGNIPYKIGKLRSLESLDLSKNKLGGEIPQGLSDLTYLIRLNLSYNNLSGRIPSGHQLDTLETDDPASMYIGNPGLCGHPVPREC

Gene3D: G3DSA:3.80.10.10
248-433 G3DSA:3.80.10.10

ISNNSLNGFVSDFRAPQLQVAVLYSNSISGTIPTSICQMRKLRILNLSNNLLSKELPHCGRKELKQQNTSSSISSSVNSMSSFSLNITTLLLSNNSFSSGFPLFLQQCPSLVFLDLTQNRFSGELPGWIGEVMPGLVILRLRSNNFSGHIPIEIMGLHNVRILDLSNNNFSGAIPQYLENLQALTS

HMMPfam: PF00560
IPR001611
288-305 LRR_1
Leucine-rich repeat

KLRILNLSNNLLSKELPH

HMMPfam: PF00560
IPR001611
406-428 LRR_1
Leucine-rich repeat

NVRILDLSNNNFSGAIPQYLENL

HMMPfam: PF00560
IPR001611
484-505 LRR_1
Leucine-rich repeat

LMSIDLSCNSLTGEIPEKLSSL

Gene3D: G3DSA:3.80.10.10
487-596 G3DSA:3.80.10.10

IDLSCNSLTGEIPEKLSSLVGLISLNLSSNLLSGNIPYKIGKLRSLESLDLSKNKLGGEIPQGLSDLTYLIRLNLSYNNLSGRIPSGHQLDTLETDDPASMYIGNPGLCG

FPrintScan: PR00019
529-542 LEURICHRPT,Leucine-rich repeat signature

LRSLESLDLSKNKL

HMMPfam: PF13516
529-551 LRR_6,Leucine Rich repeat

LRSLESLDLSKNKLGGEIPQGLS

HMMPfam: PF00560
IPR001611
556-572 LRR_1
Leucine-rich repeat

LIRLNLSYNNLSGRIPS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox