PRGDB00061831 (TIR-LRR-NBS disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-LRR-NBS disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 307135766 (HM854749)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Cucumis melo subsp. melo

Comment?

Cucumis melo subsp. melo clone Cm43_H20; Cm13_J04; Cm14_M22, *** SEQUENCING IN PROGRESS ***, 10 ordered pieces.

DNA Sequence

AAGCTCAAAATGTAAATGCATGGTTTACGGCACAACGTTGGATTATATGTTGTTCTCCCCTTGAAAGTTTACGAAGATGTAGCCATTTTGTTATTACAAGTGTTGACCCATCCTTATGGCACACCTGTGGGGTTGATGACGTCCTCAGCTCAACGTTTCAAAAAAAATTCAGTGAACGGCGGGCTTATATCTTTGGAATACACTTACCAGACAATTTCCTCATGTAAGGATATTGAGGATATTCTTGTCAAACGTTTATTTGATGAACTCTCCTACTTGTCAAATTGCAAAGCAGTGTTGCATGCAGGAAGTTATGATCCAATAGTAATAACCGATTCCAACATACAACCTATGATTTTCCCATTGCATGTAACATATAGTGGTTATACAGTGATAAGCGGAATGGAAGGCATGGGAAAAACTGCACTCGCAAATTCTCTACGCAACAAATTTAAAAGGAAAGATAACAGCAATTGGGGACAATGTTTAAATGATTCTTCAAGATTTTACTTGCTCCAAGGAAGAAAATCCCGTATATTTTCAGGATATGCGAACCCCAGACCTCACATTGGGTGAGATTTCAAGAGAGTTCTTATTAATGGGCGTTGAGATTCCAAAATGGTTCAGCTATAAGACTACATCAAATTTGGTGAGTGCTAGCTTTCGTCACTATTCAGACATGGAAAGAACTTTGGCTGCATGTGTTAGTTTCAAAGTGAATGGAGATTCATCTAGAAGAATTTCATGCAATATATTCATCTGCAATAGATTCCACTGTTCATTTTCAAGACCATTTCTTCCATCAAAATCAGAGTACATGTGGTTAGTAACAACTTCTCTGGCATGGGGCTCCTTGGATGCGCAGGATTGGAATAAAGTTGTGGTTCTGTTTGAAGTTGATGATGAGGTTAATCTGAGTATAAGAAGCTATGGTGTCCATGTCACTGAAGAGTTCAATGGGACACAAACAGATGTCAAGTGGCCAGTGGTAAATTATGGTGATTTTTATCAACCGGAGAAATTGCAAAATCTGTTGGTGAATGGTTGAAGCATGTTAATCTTAGCTATTCTACGTCATTGAAGAAAATTCCCGATTTCTCTGCGGCATCGAACCTTGAAAAATTGTACTTAAGGGATTGCACAAATTTAAGAACAATTCATAGGTCCATTTTTTGTCTTGTGAAGCTTACTCTCCTGTGCCTTAGTGGTTGCTGTATGATTAAAAAACTTCCGACAAGTTGTTTCAAGTTATGGTCTCTTAAACATTTGGATCTCTCTGGTTGCACAAAACTTGAGAAAATTCCAGACTTTTCCTCTGCATTAAACCTCGAAATTTTGCATCTCAGTCGATGCACAAATTTGAGAACAATACATAACTCTGTTTTTTCTCTTCATAAGCTCATTTCCCTATATCTTGACTTTTGTTCCACTCTTAAAACGCTTCCAACAAGCTGCTTCATGTTAACGTCTCTCAACACTTTGACTCTTTATTCCTGTCAAAAACTTGAGGAAGTTCCAGACTTGTCCTCCGCATCAAACCTTAACAGTTTGAATGTCGAAAAATGCACAAATTTAAGAGGGATTCATGAGTCTATTGGATCATTGGATAGGCTTCAAACTTTGGTCTCTAGGAAATGCACTAACCTTGTAAAGCTTCCAAGCATCCTCCGGTTAAAGTCTCTGAAGCATTTAGATCTTTCCTGGTGTAGTAAGCTTGAAAGTTTCCCAATAATTGATGAAAACATGAAATCTTTAAGGTTTCTGGATTTGAGTTTTACTGCAATAAAAGATTTACCTTCATCAATTGGATATCTTACCGAGCTCCCTCGATTAAACCTTGGCAATTGCACAAGCCTCATCTCCCTTCCCAAAACAATTTCTTTGTTAATGTCCTTGTTGGATCTTGAATTAAGGAATTGCAGGTCTCTTCAAGAAATTCCAAACCTTCCTCAAAATATACAGAATTTGGATGCCTATGGCTGTGAATTGTTGACTAAAAGTCCAGATAACATTGTGGATATAATATCACAAAAACAGGGAACAAGTGCAATTAAAGCCATAAAATTGGAGTTCCATAATCCCACAAGGCTAATTGTAGATCCACAAGCTTTTAGAAACCTGAAAAATTTGAGATTGCTTATCGTTCGAAATGCAAGATTTTGTGCAAAGATAAAGTACCTTCCCGAAAGCTTAAAGTGGATTGAGTGGCATGGATTTTCTCAACCATCTTTGCCTTCGCACTTCATTGTGAAAAATCTTGTTGGACTAGATTTGCAACATAGCTTCATCAAAGACTTTGGGAACAGACTTAAGATGGGTCATAAAATAGTTTGTGGTGAATCTCTTGAGCTTGGAAAAAGGAGTAGATTATGGTTGGAGAAAGACGTTTTGGAGGTGTTTAGTAGCAATTCACAAGGATGAGGCTGAACTTATCCAAGAAATTGTTAAACGAGTATTGTCTATAGTAAATCCAATGCAATTACTACATGTAGCCAAACATCCAGTTGGAGTTAATTCTCGACTAAGGAAAATTGAGGAGTTGGTCTCTCATATTGGGTTCGAGGGTGTTAACATGGTGGGGATGTATGGCATTGGAGGCATTGGTAAGACCACTTTGGCTAAGGCTTTGTACAATAAAATTGCTACCCAATTTGAAGGATCCTGCTTTCTACTAGATGTTAGACGAGAAGCTTCAAAGCATGGGCTCATTCAACTACAGAAAACCTTACTCAATGAGATCTTAAAGGAGGATTTGAAGGTTGTCAATTGTGATAAAGGAATTAACATCATAAGGAGTAGACTGTGTTCAAAGAAAGTTCTTATAGTTCTTGACGATGTGGATCATCGTGATCAATTAGAAGCATTGGTTGGTGAGCGCGATTGGTTTTGTCAAGGTAGTAAAATCATTGTGACGACAAGGAATAAACATTTACTTTCTAGTCATGGTTTTGATGAAATACACAATATTCTAGGATTGAATGAAGACAAAGCTATTGAGCTTTTTAGTTGGCATGCTTTCAAGAAAAATCATCCATCAAGTAATTATTTCGACCTTTCAGAACGTGTTACAAGTTATTGTAAAGGTCATCCTTTGGCTCTCGTTGTTTTGGGTTCTTTCCTTTGTAACAGAGATCAAGTAGAATGGTGTAGTATTTTAGATGAATTTGAAAACTCTTTGAACAAAGATATCAAAGATATTCTTCAATTAAGTTTTGATGGGCTCGAAGACAAAGTAAAGGATATCTTTCTTGATATTTCTTGTTTACTTGTGGGAGAGAAAGTTGAGTACGTTAAGGATACGTTGAGTGCATGCCATCATTGGCCAAACATGAAGCTAATAAGTTATTGACCAACAAGATTCAACCATGGAAGGAAGCTTTGACTTTTGCTGCTGGTTTGTCTGGTTGGGATCTAGCAAATAG


Protein sequences

Name Description Sequence
TIR-LRR-NBS disease resistance protein TIR-LRR-NBS disease resistance protein [Cucumis melo subsp. melo].

LAKHEANKLLTNKIQPWKEALTFAAGLSGWDLANSKDEAELIQEIVKRVLSIVNPMQLLHVAKHPVGVNSRLRKIEELVSHIGFEGVNMVGMYGIGGIGKTTLAKALYNKIATQFEGSCFLLDVRREASKHGLIQLQKTLLNEILKEDLKVVNCDKGINIIRSRLCSKKVLIVLDDVDHRDQLEALVGERDWFCQGSKIIVTTRNKHLLSSHGFDEIHNILGLNEDKAIELFSWHAFKKNHPSSNYFDLSERVTSYCKGHPLALVVLGSFLCNRDQVEWCSILDEFENSLNKDIKDILQLSFDGLEDKVKDIFLDISCLLVGEKVEYVKDTLSACHMGHKIVCGESLELGKRSRLWLEKDVLEVFSSNSGTSAIKAIKLEFHNPTRLIVDPQAFRNLKNLRLLIVRNARFCAKIKYLPESLKWIEWHGFSQPSLPSHFIVKNLVGLDLQHSFIKDFGNRLKVGEWLKHVNLSYSTSLKKIPDFSAASNLEKLYLRDCTNLRTIHRSIFCLVKLTLLCLSGCCMIKKLPTSCFKLWSLKHLDLSGCTKLEKIPDFSSALNLEILHLSRCTNLRTIHNSVFSLHKLISLYLDFCSTLKTLPTSCFMLTSLNTLTLYSCQKLEEVPDLSSASNLNSLNVEKCTNLRGIHESIGSLDRLQTLVSRKCTNLVKLPSILRLKSLKHLDLSWCSKLESFPIIDENMKSLRFLDLSFTAIKDLPSSIGYLTELPRLNLGNCTSLISLPKTISLLMSLLDLELRNCRSLQEIPNLPQNIQNLDAYGCELLTKSPDNIVDIISQKQDLTLGEISREFLLMGVEIPKWFSYKTTSNLVSASFRHYSDMERTLAACVSFKVNGDSSRRISCNIFICNRFHCSFSRPFLPSKSEYMWLVTTSLAWGSLDAQDWNKVVVLFEVDDEVNLSIRSYGVHVTEEFNGTQTDVKWPVVNYGDFYQPEKLQNLDIEDILVKRLFDELSYLSNCKAVLHAGSYDPIVITDSNIQPMIFPLHVTYSGYTVISGMEGMGKTALANSLRNKFKRKDNSNWGQCLNDSSRFYLLQGRKSRIFSGYANPKAQNVNAWFTAQRWIICCSPLESLRRCSHFVITSVDPSLWHTCGVDDVLSSTFQKKFSERRAYIFGIHLPDNFLM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
37-865 PTHR11017:SF20,SUBFAMILY NOT NAMED

DEAELIQEIVKRVLSIVNPMQLLHVAKHPVGVNSRLRKIEELVSHIGFEGVNMVGMYGIGGIGKTTLAKALYNKIATQFEGSCFLLDVRREASKHGLIQLQKTLLNEILKEDLKVVNCDKGINIIRSRLCSKKVLIVLDDVDHRDQLEALVGERDWFCQGSKIIVTTRNKHLLSSHGFDEIHNILGLNEDKAIELFSWHAFKKNHPSSNYFDLSERVTSYCKGHPLALVVLGSFLCNRDQVEWCSILDEFENSLNKDIKDILQLSFDGLEDKVKDIFLDISCLLVGEKVEYVKDTLSACHMGHKIVCGESLELGKRSRLWLEKDVLEVFSSNSGTSAIKAIKLEFHNPTRLIVDPQAFRNLKNLRLLIVRNARFCAKIKYLPESLKWIEWHGFSQPSLPSHFIVKNLVGLDLQHSFIKDFGNRLKVGEWLKHVNLSYSTSLKKIPDFSAASNLEKLYLRDCTNLRTIHRSIFCLVKLTLLCLSGCCMIKKLPTSCFKLWSLKHLDLSGCTKLEKIPDFSSALNLEILHLSRCTNLRTIHNSVFSLHKLISLYLDFCSTLKTLPTSCFMLTSLNTLTLYSCQKLEEVPDLSSASNLNSLNVEKCTNLRGIHESIGSLDRLQTLVSRKCTNLVKLPSILRLKSLKHLDLSWCSKLESFPIIDENMKSLRFLDLSFTAIKDLPSSIGYLTELPRLNLGNCTSLISLPKTISLLMSLLDLELRNCRSLQEIPNLPQNIQNLDAYGCELLTKSPDNIVDIISQKQDLTLGEISREFLLMGVEIPKWFSYKTTSNLVSASFRHYSDMERTLAACVSFKVNGDSSRRISCNIFICN

HMMPanther: PTHR11017
37-865 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DEAELIQEIVKRVLSIVNPMQLLHVAKHPVGVNSRLRKIEELVSHIGFEGVNMVGMYGIGGIGKTTLAKALYNKIATQFEGSCFLLDVRREASKHGLIQLQKTLLNEILKEDLKVVNCDKGINIIRSRLCSKKVLIVLDDVDHRDQLEALVGERDWFCQGSKIIVTTRNKHLLSSHGFDEIHNILGLNEDKAIELFSWHAFKKNHPSSNYFDLSERVTSYCKGHPLALVVLGSFLCNRDQVEWCSILDEFENSLNKDIKDILQLSFDGLEDKVKDIFLDISCLLVGEKVEYVKDTLSACHMGHKIVCGESLELGKRSRLWLEKDVLEVFSSNSGTSAIKAIKLEFHNPTRLIVDPQAFRNLKNLRLLIVRNARFCAKIKYLPESLKWIEWHGFSQPSLPSHFIVKNLVGLDLQHSFIKDFGNRLKVGEWLKHVNLSYSTSLKKIPDFSAASNLEKLYLRDCTNLRTIHRSIFCLVKLTLLCLSGCCMIKKLPTSCFKLWSLKHLDLSGCTKLEKIPDFSSALNLEILHLSRCTNLRTIHNSVFSLHKLISLYLDFCSTLKTLPTSCFMLTSLNTLTLYSCQKLEEVPDLSSASNLNSLNVEKCTNLRGIHESIGSLDRLQTLVSRKCTNLVKLPSILRLKSLKHLDLSWCSKLESFPIIDENMKSLRFLDLSFTAIKDLPSSIGYLTELPRLNLGNCTSLISLPKTISLLMSLLDLELRNCRSLQEIPNLPQNIQNLDAYGCELLTKSPDNIVDIISQKQDLTLGEISREFLLMGVEIPKWFSYKTTSNLVSASFRHYSDMERTLAACVSFKVNGDSSRRISCNIFICN

superfamily: SSF52540
53-294 SSF52540

VNPMQLLHVAKHPVGVNSRLRKIEELVSHIGFEGVNMVGMYGIGGIGKTTLAKALYNKIATQFEGSCFLLDVRREASKHGLIQLQKTLLNEILKEDLKVVNCDKGINIIRSRLCSKKVLIVLDDVDHRDQLEALVGERDWFCQGSKIIVTTRNKHLLSSHGFDEIHNILGLNEDKAIELFSWHAFKKNHPSSNYFDLSERVTSYCKGHPLALVVLGSFLCNRDQVEWCSILDEFENSLNKDI

Gene3D: G3DSA:3.40.50.300
72-212 G3DSA:3.40.50.300

LRKIEELVSHIGFEGVNMVGMYGIGGIGKTTLAKALYNKIATQFEGSCFLLDVRREASKHGLIQLQKTLLNEILKEDLKVVNCDKGINIIRSRLCSKKVLIVLDDVDHRDQLEALVGERDWFCQGSKIIVTTRNKHLLSSH

HMMPfam: PF00931
IPR002182
76-326 NB-ARC,NBS
NB-ARC

EELVSHIGFEGVNMVGMYGIGGIGKTTLAKALYNKIATQFEGSCFLLDVRREASKHGLIQLQKTLLNEILKEDLKVVNCDKGINIIRSRLCSKKVLIVLDDVDHRDQLEALVGERDWFCQGSKIIVTTRNKHLLSSHGFDEIHNILGLNEDKAIELFSWHAFKKNHPSSNYFDLSERVTSYCKGHPLALVVLGSFLCNRDQVEWCSILDEFENSLNKDIKDILQLSFDGLEDKVKDIFLDISCLLVGEKVE

HMMSmart: SM00382
IPR003593
86-223 AAA,NBS
ATPase, AAA+ type, core

GVNMVGMYGIGGIGKTTLAKALYNKIATQFEGSCFLLDVRREASKHGLIQLQKTLLNEILKEDLKVVNCDKGINIIRSRLCSKKVLIVLDDVDHRDQLEALVGERDWFCQGSKIIVTTRNKHLLSSHGFDEIHNILGL

FPrintScan: PR00364
IPR000767
89-104 DISEASERSIST
Disease resistance protein

MVGMYGIGGIGKTTLA

FPrintScan: PR00364
IPR000767
164-178 DISEASERSIST
Disease resistance protein

RLCSKKVLIVLDDVD

FPrintScan: PR00364
IPR000767
257-271 DISEASERSIST
Disease resistance protein

CKGHPLALVVLGSFL

superfamily: SSF46785
292-366 SSF46785

KDIKDILQLSFDGLEDKVKDIFLDISCLLVGEKVEYVKDTLSACHMGHKIVCGESLELGKRSRLWLEKDVLEVFS

Gene3D: G3DSA:3.80.10.10
375-582 G3DSA:3.80.10.10

KAIKLEFHNPTRLIVDPQAFRNLKNLRLLIVRNARFCAKIKYLPESLKWIEWHGFSQPSLPSHFIVKNLVGLDLQHSFIKDFGNRLKVGEWLKHVNLSYSTSLKKIPDFSAASNLEKLYLRDCTNLRTIHRSIFCLVKLTLLCLSGCCMIKKLPTSCFKLWSLKHLDLSGCTKLEKIPDFSSALNLEILHLSRCTNLRTIHNSVFSLH

superfamily: SSF52058
377-779 SSF52058,LRR

IKLEFHNPTRLIVDPQAFRNLKNLRLLIVRNARFCAKIKYLPESLKWIEWHGFSQPSLPSHFIVKNLVGLDLQHSFIKDFGNRLKVGEWLKHVNLSYSTSLKKIPDFSAASNLEKLYLRDCTNLRTIHRSIFCLVKLTLLCLSGCCMIKKLPTSCFKLWSLKHLDLSGCTKLEKIPDFSSALNLEILHLSRCTNLRTIHNSVFSLHKLISLYLDFCSTLKTLPTSCFMLTSLNTLTLYSCQKLEEVPDLSSASNLNSLNVEKCTNLRGIHESIGSLDRLQTLVSRKCTNLVKLPSILRLKSLKHLDLSWCSKLESFPIIDENMKSLRFLDLSFTAIKDLPSSIGYLTELPRLNLGNCTSLISLPKTISLLMSLLDLELRNCRSLQEIPNLPQNIQNLDAYGCE

HMMPfam: PF00560
IPR001611
488-508 LRR_1
Leucine-rich repeat

NLEKLYLRDCTNLRTIHRSIF

HMMPfam: PF00560
IPR001611
536-556 LRR_1
Leucine-rich repeat

SLKHLDLSGCTKLEKIPDFSS

HMMPfam: PF00560
IPR001611
559-580 LRR_1
Leucine-rich repeat

NLEILHLSRCTNLRTIHNSVFS

Gene3D: G3DSA:3.80.10.10
583-791 G3DSA:3.80.10.10

KLISLYLDFCSTLKTLPTSCFMLTSLNTLTLYSCQKLEEVPDLSSASNLNSLNVEKCTNLRGIHESIGSLDRLQTLVSRKCTNLVKLPSILRLKSLKHLDLSWCSKLESFPIIDENMKSLRFLDLSFTAIKDLPSSIGYLTELPRLNLGNCTSLISLPKTISLLMSLLDLELRNCRSLQEIPNLPQNIQNLDAYGCELLTKSPDNIVDI

FPrintScan: PR00364
IPR000767
673-689 DISEASERSIST
Disease resistance protein

LRLKSLKHLDLSWCSKL


List of References

Hans van Leeuwen, Amparo Monfort, Hong-Bin Zhang, Pere Puigdomènech
Identification and characterisation of a melon genomic region containing a resistance gene cluster from a constructed BAC library. Microcolinearity between Cucumis melo and Arabidopsis thaliana.
Plant Mol. Biol.: 2003, 51(5);703-18
PubMed:12678558 WorldCat.org (P p)

Wim Deleu, Víctor González, Amparo Monfort, Abdelhafid Bendahmane, Pere Puigdomènech, Pere Arús, Jordi Garcia-Mas
Structure of two melon regions reveals high microsynteny with sequenced plant species.
Mol. Genet. Genomics: 2007, 278(6);611-22
PubMed:17665215 WorldCat.org DOI (P p)

Víctor M González, Jordi Garcia-Mas, Pere Arús, Pere Puigdomènech
Generation of a BAC-based physical map of the melon genome.
BMC Genomics: 2010, 11();339
PubMed:20509895 WorldCat.org DOI (I e)

Víctor M González, Andrej Benjak, Elizabeth Marie Hénaff, Gisela Mir, Josep M Casacuberta, Jordi Garcia-Mas, Pere Puigdomènech
Sequencing of 6.7 Mb of the melon genome using a BAC pooling strategy.
BMC Plant Biol.: 2010, 10();246
PubMed:21073723 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox