PRGDB00061832 (TIR-NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR-NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 307135766 (HM854749)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Cucumis melo subsp. melo

Comment?

Cucumis melo subsp. melo clone Cm43_H20; Cm13_J04; Cm14_M22, *** SEQUENCING IN PROGRESS ***, 10 ordered pieces.

DNA Sequence

CTTCCTGGAGCTTAGAATTGTGAAAGATTGAAGCATGTTGATCTTAGCTACTCTACTTTATTGGAGAATATTCCTGATTTCTCTGCAGCATCAAACCTTGAAGAATTGAATCTCATCAATTGCACAAATTTAAGAATGATAGATAAGTCTGTTTTTTCTCTCAATAAGCTTAATGTCCTAAACCTTTATGGTTGTTCTAACCTTAAAAAGCTTCCAAGAGGCTACTTCATGTTAAGTTCTCTTAATGAATTGAATCTCTCTTACTGCAAAAATCTTAAGAAAATTCCAGACTTCTCTGCAGCATTTAAGAGCTTGTATCTCCAAAAATGCTCAAATTTAAGAATGATTCATGAATCTGTTGGATCTTTGAAGAAGCTTGAACAATTGAACCTTAGACAATGCACTAACCTGGTAAAGCTTCCAAGCTATCTCAGGTTAAAGTCTCTTGAATATTTATCACTTTCTGGGTGTTGTAAGCTTGAAAGCTTCCCAACAATTGCTGAAAACATGAAATCTTTATACGAATTGGATTTGGATTTTACTGCCATAAAGGAGTTACCTTCATCAATTGGATATCTTACTAAGCTTTCTATATTAAAACTTAACGGTTGCACAAACCTCATCTCCCTTCCCAATACAATTTATTTGTTAAGGAATCTTGAGAATCTTCTTCTTAGTGGCTGTTCTATATTTGGAATGTTTCCCCATACATGGGACCCAACCATCCCAACCATCCAACAAAGAAAGATGAGGGTGCTAAGCGAGTGTCCACCTTGTGGAGATGTCCAAGGAGAGATTAGTGACGAAGGAGGCTGATCTTATTGGAGATCTTGTTAAAAATGTTTTGTCTACATTAAATCGCACTTGCACGCCTTTATATGTAGCTAAGTATCCAGTTGGAATTGATTCAAAATTAGAATATATGAAGCTTCAGTCACATAATCTTTTTGAGAAGAGCAACAAATTCCATTATCAGACACAACATGAGTATGAGTTTGATACGGGTGTTTACTTGGTGGGGATATATGGCATTGGAGGTATTGGTAAGACAACTTTGGCTAAAGCTTTATACAACAAAATTGCTAGCCAATTTGAAGGTTGTTGCTTTCTATCAAATGTTAGAGAAGCTTCCAAGCAATTCAATGGCCTTGCTCAATTACAGGAAAGCCTACTCTATGAGATCCTAACGGTTGATTTGAAGATGGATTCTTCCACGGAATCATCGACATTCAAATGGAGTTATGATGTGTTTTTGAGTTTCAGGGGAGAGGATACTCGCACTAATTTCACTAGTCATCTTGATATGGCTTTGCGTCAAAAGGGTGTCAACGTCTTCATAGACGACAAGCTTGAAAGGGGTGAGCAAATTTCTGAATCCCTTTTCAAATCTATACAGGAAGCTTTAATTTCTATTGTTATATTCTCTCAAAATTATGCATCTTCTTCCTGGTGTCTGGATGAATTGGTGAAAATAATTGAGTGTAAGAAATCCAAGGGCCAGATTGTTTTGCCAATTTTCTATAAGGTGGATCCGTCGGATATACGAAAACAATCTGGTACCTTCGGAGAAGCACTGGCCAAACATCAAGCTAAGTTCCAAACAAAGACCCAAATTTGGAGGGAAGCTTTAACTACTGCTGCTAACTTGTCTGGTTGGGATCTAGGAACCAG


Protein sequences

Name Description Sequence
TIR-NBS-LRR disease resistance protein TIR-NBS-LRR disease resistance protein [Cucumis melo subsp. melo].

MDSSTESSTFKWSYDVFLSFRGEDTRTNFTSHLDMALRQKGVNVFIDDKLERGEQISESLFKSIQEALISIVIFSQNYASSSWCLDELVKIIECKKSKGQIVLPIFYKVDPSDIRKQSGTFGEALAKHQAKFQTKTQIWREALTTAANLSGWDLGTRKEADLIGDLVKNVLSTLNRTCTPLYVAKYPVGIDSKLEYMKLQSHNLFEKSNKFHYQTQHEYEFDTGVYLVGIYGIGGIGKTTLAKALYNKIASQFEGCCFLSNVREASKQFNGLAQLQESLLYEILTVDLKRKMRVLSECPPCGDVQGEISDNCERLKHVDLSYSTLLENIPDFSAASNLEELNLINCTNLRMIDKSVFSLNKLNVLNLYGCSNLKKLPRGYFMLSSLNELNLSYCKNLKKIPDFSAAFKSLYLQKCSNLRMIHESVGSLKKLEQLNLRQCTNLVKLPSYLRLKSLEYLSLSGCCKLESFPTIAENMKSLYELDLDFTAIKELPSSIGYLTKLSILKLNGCTNLISLPNTIYLLRNLENLLLSGCSIFGMFPHTWDPTIPTIQQLPGA

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-152 TIR
Toll-Interleukin receptor

DSSTESSTFKWSYDVFLSFRGEDTRTNFTSHLDMALRQKGVNVFIDDKLERGEQISESLFKSIQEALISIVIFSQNYASSSWCLDELVKIIECKKSKGQIVLPIFYKVDPSDIRKQSGTFGEALAKHQAKFQTKTQIWREALTTAANLSGW

Gene3D: G3DSA:3.40.50.10140
11-135 G3DSA:3.40.50.10140

KWSYDVFLSFRGEDTRTNFTSHLDMALRQKGVNVFIDDKLERGEQISESLFKSIQEALISIVIFSQNYASSSWCLDELVKIIECKKSKGQIVLPIFYKVDPSDIRKQSGTFGEALAKHQAKFQTK

ProfileScan: PS50104
IPR000157
12-149 TIR
Toll-Interleukin receptor

WSYDVFLSFRGEDTRTNFTSHLDMALRQKGVNVFIDDKLERGEQISESLFKSIQEALISIVIFSQNYASSSWCLDELVKIIECKKSKGQIVLPIFYKVDPSDIRKQSGTFGEALAKHQAKFQTKTQIWREALTTAANL

HMMSmart: SM00255
IPR000157
13-149 TIR
Toll-Interleukin receptor

SYDVFLSFRGEDTRTNFTSHLDMALRQKGVNVFIDDKLERGEQISESLFKSIQEALISIVIFSQNYASSSWCLDELVKIIECKKSKGQIVLPIFYKVDPSDIRKQSGTFGEALAKHQAKFQTKTQIWREALTTAANL

HMMPfam: PF01582
IPR000157
16-143 TIR
Toll-Interleukin receptor

VFLSFRGEDTRTNFTSHLDMALRQKGVNVFIDDKLERGEQISESLFKSIQEALISIVIFSQNYASSSWCLDELVKIIECKKSKGQIVLPIFYKVDPSDIRKQSGTFGEALAKHQAKFQTKTQIWREAL

HMMPanther: PTHR23155
24-535 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DTRTNFTSHLDMALRQKGVNVFIDDKLERGEQISESLFKSIQEALISIVIFSQNYASSSWCLDELVKIIECKKSKGQIVLPIFYKVDPSDIRKQSGTFGEALAKHQAKFQTKTQIWREALTTAANLSGWDLGTRKEADLIGDLVKNVLSTLNRTCTPLYVAKYPVGIDSKLEYMKLQSHNLFEKSNKFHYQTQHEYEFDTGVYLVGIYGIGGIGKTTLAKALYNKIASQFEGCCFLSNVREASKQFNGLAQLQESLLYEILTVDLKRKMRVLSECPPCGDVQGEISDNCERLKHVDLSYSTLLENIPDFSAASNLEELNLINCTNLRMIDKSVFSLNKLNVLNLYGCSNLKKLPRGYFMLSSLNELNLSYCKNLKKIPDFSAAFKSLYLQKCSNLRMIHESVGSLKKLEQLNLRQCTNLVKLPSYLRLKSLEYLSLSGCCKLESFPTIAENMKSLYELDLDFTAIKELPSSIGYLTKLSILKLNGCTNLISLPNTIYLLRNLENLLLSGCSI

HMMPanther: PTHR23155:SF252
24-535 PTHR23155:SF252,SUBFAMILY NOT NAMED

DTRTNFTSHLDMALRQKGVNVFIDDKLERGEQISESLFKSIQEALISIVIFSQNYASSSWCLDELVKIIECKKSKGQIVLPIFYKVDPSDIRKQSGTFGEALAKHQAKFQTKTQIWREALTTAANLSGWDLGTRKEADLIGDLVKNVLSTLNRTCTPLYVAKYPVGIDSKLEYMKLQSHNLFEKSNKFHYQTQHEYEFDTGVYLVGIYGIGGIGKTTLAKALYNKIASQFEGCCFLSNVREASKQFNGLAQLQESLLYEILTVDLKRKMRVLSECPPCGDVQGEISDNCERLKHVDLSYSTLLENIPDFSAASNLEELNLINCTNLRMIDKSVFSLNKLNVLNLYGCSNLKKLPRGYFMLSSLNELNLSYCKNLKKIPDFSAAFKSLYLQKCSNLRMIHESVGSLKKLEQLNLRQCTNLVKLPSYLRLKSLEYLSLSGCCKLESFPTIAENMKSLYELDLDFTAIKELPSSIGYLTKLSILKLNGCTNLISLPNTIYLLRNLENLLLSGCSI

superfamily: SSF52058
158-540 SSF52058,LRR

KEADLIGDLVKNVLSTLNRTCTPLYVAKYPVGIDSKLEYMKLQSHNLFEKSNKFHYQTQHEYEFDTGVYLVGIYGIGGIGKTTLAKALYNKIASQFEGCCFLSNVREASKQFNGLAQLQESLLYEILTVDLKRKMRVLSECPPCGDVQGEISDNCERLKHVDLSYSTLLENIPDFSAASNLEELNLINCTNLRMIDKSVFSLNKLNVLNLYGCSNLKKLPRGYFMLSSLNELNLSYCKNLKKIPDFSAAFKSLYLQKCSNLRMIHESVGSLKKLEQLNLRQCTNLVKLPSYLRLKSLEYLSLSGCCKLESFPTIAENMKSLYELDLDFTAIKELPSSIGYLTKLSILKLNGCTNLISLPNTIYLLRNLENLLLSGCSIFGMFP

Gene3D: G3DSA:3.40.50.300
211-260 G3DSA:3.40.50.300

FHYQTQHEYEFDTGVYLVGIYGIGGIGKTTLAKALYNKIASQFEGCCFLS

HMMPfam: PF00931
IPR002182
223-288 NB-ARC,NBS
NB-ARC

TGVYLVGIYGIGGIGKTTLAKALYNKIASQFEGCCFLSNVREASKQFNGLAQLQESLLYEILTVDL

FPrintScan: PR00364
IPR000767
227-242 DISEASERSIST
Disease resistance protein

LVGIYGIGGIGKTTLA

Gene3D: G3DSA:3.80.10.10
295-432 G3DSA:3.80.10.10

LSECPPCGDVQGEISDNCERLKHVDLSYSTLLENIPDFSAASNLEELNLINCTNLRMIDKSVFSLNKLNVLNLYGCSNLKKLPRGYFMLSSLNELNLSYCKNLKKIPDFSAAFKSLYLQKCSNLRMIHESVGSLKKLE

HMMPfam: PF00560
IPR001611
385-404 LRR_1
Leucine-rich repeat

SLNELNLSYCKNLKKIPDFS

HMMPfam: PF13855
430-487 LRR_8,Leucine rich repeat

KLEQLNLRQCTNLVKLPSYLRLKSLEYLSLSGCCKLESFPTIAENMKSLYELDLDFTA

Gene3D: G3DSA:3.80.10.10
433-535 G3DSA:3.80.10.10

QLNLRQCTNLVKLPSYLRLKSLEYLSLSGCCKLESFPTIAENMKSLYELDLDFTAIKELPSSIGYLTKLSILKLNGCTNLISLPNTIYLLRNLENLLLSGCSI

FPrintScan: PR00364
IPR000767
449-465 DISEASERSIST
Disease resistance protein

LRLKSLEYLSLSGCCKL


List of References

Hans van Leeuwen, Amparo Monfort, Hong-Bin Zhang, Pere Puigdomènech
Identification and characterisation of a melon genomic region containing a resistance gene cluster from a constructed BAC library. Microcolinearity between Cucumis melo and Arabidopsis thaliana.
Plant Mol. Biol.: 2003, 51(5);703-18
PubMed:12678558 WorldCat.org (P p)

Wim Deleu, Víctor González, Amparo Monfort, Abdelhafid Bendahmane, Pere Puigdomènech, Pere Arús, Jordi Garcia-Mas
Structure of two melon regions reveals high microsynteny with sequenced plant species.
Mol. Genet. Genomics: 2007, 278(6);611-22
PubMed:17665215 WorldCat.org DOI (P p)

Víctor M González, Jordi Garcia-Mas, Pere Arús, Pere Puigdomènech
Generation of a BAC-based physical map of the melon genome.
BMC Genomics: 2010, 11();339
PubMed:20509895 WorldCat.org DOI (I e)

Víctor M González, Andrej Benjak, Elizabeth Marie Hénaff, Gisela Mir, Josep M Casacuberta, Jordi Garcia-Mas, Pere Puigdomènech
Sequencing of 6.7 Mb of the melon genome using a BAC pooling strategy.
BMC Plant Biol.: 2010, 10();246
PubMed:21073723 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox