PRGDB00061851 (disease resistance protein RPP8)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP8
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 291464704 (GU646315)
Gene Class CNL
Domain Type LRR, NBS
Gene Species Arabidopsis lyrata subsp. petraea

Comment?

Arabidopsis lyrata subsp. petraea ecotype NT-67 disease resistance protein RPP8 (RPP8) gene, RPP8-1 allele, partial cds.

DNA Sequence

GTGAAGTTTAAAGGAGGGAAGTTACCTTCTAGCATTGGAGGGCTCATCCACTTGAGATTCTTGAGCTTATTCAACGCTGGAGTATCTCATCTACCTTCTACTATGCGGAATTTAAAGCTTCTGCTCTATCTGAACTTAGATGTTGCTATTGGGGAACCAGTTCATGTGCCAAATGTTTTGAAAGAGATGCTAGAGTTGAGGTACCTTTCCCTACCTATGCTTGTGCATGATAAAACCAAGTTGGAAATTGGTGATTTAGTTAACCTGGAGGAATTGTGGGTTTTCTCAACGCAACACAGTAGTGTGACAGACCTCCTCCGTATGACCAAGCTTAGGTCTCTCTCTATATCTTTGAGCGAAAGGTGTACTTTTGAAACCCTATCGTCATCTCTCCGTGAATTGCGAAACCTCGAGACGCTTCATTTCCATTCTATCTACGATGAAACCGATATGGTTGATTATGTGGGAGAGTTGGATCTGGATTTTATTCATCTAAAAGAGTTAGGATTCCTGACAGTACGTATGTCAAAGATTCCTGATCAACATCAATTCCCTCCCCACCTTGAACACATATATCTATATGATTGCGGCATTGAGGAGGATCCAATGCCGATTCTAGAAAAGTTGCTTCATTTGAAGTCGGTTAAATTAAGAAATGAGGCTTTCGTTGGGAGGAGAATGGTGTGCTCAAAAGGTGGATTTCCTCAATTATCTACTCTAGAAATATCTGAAGAATTAGAGTTGGAAGAGTGGATAGTAGAAGAAGGGTCG


Protein sequences

Name Description Sequence
disease resistance protein RPP8 disease resistance protein RPP8 [Arabidopsis lyrata subsp. petraea].

VKFKGGKLPSSIGGLIHLRFLSLFNAGVSHLPSTMRNLKLLLYLNLDVAIGEPVHVPNVLKEMLELRYLSLPMLVHDKTKLEIGDLVNLEELWVFSTQHSSVTDLLRMTKLRSLSISLSERCTFETLSSSLRELRNLETLHFHSIYDETDMVDYVGELDLDFIHLKELGFLTVRMSKIPDQHQFPPHLEHIYLYDCGIEEDPMPILEKLLHLKSVKLRNEAFVGRRMVCSKGGFPQLSTLEISEELELEEWIVEEGS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
6-244 G3DSA:3.80.10.10

GKLPSSIGGLIHLRFLSLFNAGVSHLPSTMRNLKLLLYLNLDVAIGEPVHVPNVLKEMLELRYLSLPMLVHDKTKLEIGDLVNLEELWVFSTQHSSVTDLLRMTKLRSLSISLSERCTFETLSSSLRELRNLETLHFHSIYDETDMVDYVGELDLDFIHLKELGFLTVRMSKIPDQHQFPPHLEHIYLYDCGIEEDPMPILEKLLHLKSVKLRNEAFVGRRMVCSKGGFPQLSTLEISE

superfamily: SSF52058
6-244 SSF52058,LRR

GKLPSSIGGLIHLRFLSLFNAGVSHLPSTMRNLKLLLYLNLDVAIGEPVHVPNVLKEMLELRYLSLPMLVHDKTKLEIGDLVNLEELWVFSTQHSSVTDLLRMTKLRSLSISLSERCTFETLSSSLRELRNLETLHFHSIYDETDMVDYVGELDLDFIHLKELGFLTVRMSKIPDQHQFPPHLEHIYLYDCGIEEDPMPILEKLLHLKSVKLRNEAFVGRRMVCSKGGFPQLSTLEISE

HMMPanther: PTHR23155:SF231
7-257 PTHR23155:SF231,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

KLPSSIGGLIHLRFLSLFNAGVSHLPSTMRNLKLLLYLNLDVAIGEPVHVPNVLKEMLELRYLSLPMLVHDKTKLEIGDLVNLEELWVFSTQHSSVTDLLRMTKLRSLSISLSERCTFETLSSSLRELRNLETLHFHSIYDETDMVDYVGELDLDFIHLKELGFLTVRMSKIPDQHQFPPHLEHIYLYDCGIEEDPMPILEKLLHLKSVKLRNEAFVGRRMVCSKGGFPQLSTLEISEELELEEWIVEEGS

HMMPanther: PTHR23155
7-257 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KLPSSIGGLIHLRFLSLFNAGVSHLPSTMRNLKLLLYLNLDVAIGEPVHVPNVLKEMLELRYLSLPMLVHDKTKLEIGDLVNLEELWVFSTQHSSVTDLLRMTKLRSLSISLSERCTFETLSSSLRELRNLETLHFHSIYDETDMVDYVGELDLDFIHLKELGFLTVRMSKIPDQHQFPPHLEHIYLYDCGIEEDPMPILEKLLHLKSVKLRNEAFVGRRMVCSKGGFPQLSTLEISEELELEEWIVEEGS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox