PRGDB00061867 (disease resistance protein RPS5)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPS5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 291464631 (GU646274)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis lyrata subsp. petraea

Comment?

Arabidopsis lyrata subsp. petraea ecotype ST-30 disease resistance protein RPS5 (RPS5) gene, RPS5-2 allele, partial cds.

DNA Sequence

GAGATTGAAGAGATATTTGACAGTCACGAGTGTGCTGCACTTACAACTCTATTTCTCCAAAAGAACGATATGGTAAAGATCTCGGCTGAATTCTTTCGATGTATGCCTCATCTGGTGGTTTTAGATCTATCAGAGAACCACAGTCTTAATGATTTACCAGAAGAAATATCAGAGTTGGTCTCTTTGAGATATTTCAACTTGTCATATACTTGTATACATCAACTACCCGTTGGTTTATGGACATTGAAAAAGCTAATACATCTGAATCTCGAACACATGAGCAGTCTTGGGAGTATATTAGGGATATCAAATTTGTGGAATTTGAGGACATTGGGACTACGAGATTCCAAACTGTTGCTAGATATGAGTTTAGTGAAGGAGCTGCAGCTCTTAGAACATCTAGAAGTTGTGACCCTAGATATATCATCAAGTTTGGTTGCAGAGCCATTGCTATGCTCTCACAGGTTGGTGGAATGTATAAAAGAGGTAGATATTAAGTACCTTAAGGAAGAATCAGTGAGAGTATTGACTCTGCCAACCATGGGTAATCTCCGTAGGCTCGGGATAAAAATGTGTGGAATGAGGGAGATAAAGATAGAGAGTACAACTTCATCATCGTCGCGAAACAAAAGTCCCACAACTCCATGCTTCTCAAACCTCTCCAGAGTCTTTATAGCTAAATGCCATGGTCTTAAGGATTTGACGTGGCTGCTGTTTGCTCCGAATCTTACTTTTCTTGAAGTTGGGTTCTCAAAGGAAGTAGAGGATATAATTAGCGAAGAGAAAGCTGACGAGCATTCTTCAGCTACGATTGTTCCTTTTAGGAAACTAGAAACGCTACACCTGTTTGAATTACGC


Protein sequences

Name Description Sequence
disease resistance protein RPS5 disease resistance protein RPS5 [Arabidopsis lyrata subsp. petraea].

EIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKADEHSSATIVPFRKLETLHLFELR

disease resistance protein RPS5 disease resistance protein RPS5 [Arabidopsis lyrata subsp. petraea].

EIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKADEHSSATIVPFRKLETLHLFELR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
1-286 PTHR23155:SF108,SUBFAMILY NOT NAMED

EIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKADEHSSATIVPFRKLETLHLFELR

HMMPanther: PTHR23155
1-286 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKADEHSSATIVPFRKLETLHLFELR

HMMPanther: PTHR23155:SF108
1-286 PTHR23155:SF108,SUBFAMILY NOT NAMED

EIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKADEHSSATIVPFRKLETLHLFELR

HMMPanther: PTHR23155
1-286 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKADEHSSATIVPFRKLETLHLFELR

Gene3D: G3DSA:3.80.10.10
8-201 G3DSA:3.80.10.10

SHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIES

Gene3D: G3DSA:3.80.10.10
8-201 G3DSA:3.80.10.10

SHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIES

superfamily: SSF52047
11-284 SSF52047,LRR

CAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKADEHSSATIVPFRKLETLHLFE

superfamily: SSF52047
11-284 SSF52047,LRR

CAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEKADEHSSATIVPFRKLETLHLFE

HMMPfam: PF13855
14-70 LRR_8,Leucine rich repeat

LTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYT

HMMPfam: PF13855
14-70 LRR_8,Leucine rich repeat

LTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNDLPEEISELVSLRYFNLSYT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox