PRGDB00061899 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 310696702 (HM565939)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Vitis labrusca

Comment?

Vitis labrusca clone pSCA-Vlub 1 putative disease resistance protein gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAGACGACTTTGGCTCAAGTGGTCTTCAATGACAGGGAAATGGAGGCTCGTTTTGAGAGGAGGATGTGGGTGTCTGTCACTGGGACACCTAATGAAAAACGGATTTTGAGAAGCATGTTGAGGAACTTGGGTGATATGAATGTGGGAGATGATTGTGGTGAGTTGTTGAGGAAAATAAATCAATACCTCTTGGGCAAGAGGTTTTTGCTTGTCATGGATGATGTGGGGGAAAACACAAATACTTGGTGGCGCAAAATCAGTGATGGATTGCCTAAAGGAAATGGGAGTAGTATTATTATCACTACAAGAACTAAGGAAGTCGCAACAATGATGGGAGTGGAGGAAGAGAGAACACATCGGCCCAAAGTCCTCAGTAAGGATGATAGTTGGTTGCTCTTCCGCAATGTAGCATTTGCTGCAAATGGAGGCATTTGTACTTCCTCTGAACTGGAGAACATTGGGAGGGAGATTGTACATAAATGTGGGGGCCTCCCCTTAGCCC


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Vitis labrusca].

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIIITTRTKEVATMMGVEEERTHRPKVLSKDDSWLLFRNVAFAANGGICTSSELENIGREIVHKCGGLPLA

putative disease resistance protein putative disease resistance protein [Vitis labrusca].

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIIITTRTKEVATMMGVEEERTHRPKVLSKDDSWLLFRNVAFAANGGICTSSELENIGREIVHKCGGLPLA

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-171 P-loop containing nucleoside triphosphate hydrolases

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIIITTRTKEVATMMGVEEERTHRPKVLSKDDSWLLFRNVAFAANGGICTSSELENIGREIVHKCGGLPLA

HMMPanther: PTHR23155:SF244
1-104 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIII

HMMPanther: PTHR23155
1-104 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIII

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIIITTRTKEVATMMGVEEERTHRPKVLSKDDSWLLFRNVAFAANGGICTSSELENIGREIVHKCGGLPLA

HMMPanther: PTHR23155:SF244
1-104 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIII

HMMPanther: PTHR23155
1-104 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIII

superfamily: SSF52540
1-171 P-loop containing nucleoside triphosphate hydrolases

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIIITTRTKEVATMMGVEEERTHRPKVLSKDDSWLLFRNVAFAANGGICTSSELENIGREIVHKCGGLPLA

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

GGVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIIITTRTKEVATMMGVEEERTHRPKVLSKDDSWLLFRNVAFAANGGICTSSELENIGREIVHKCGGLPLA

Gene3D: G3DSA:3.40.50.300
2-110 no description

GVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIIITTRTKE

Gene3D: G3DSA:3.40.50.300
2-110 no description

GVGKTTLAQVVFNDREMEARFERRMWVSVTGTPNEKRILRSMLRNLGDMNVGDDCGELLRKINQYLLGKRFLLVMDDVGENTNTWWRKISDGLPKGNGSSIIITTRTKE

FPrintScan: PR00364
IPR000767
66-80 DISEASERSIST
Disease resistance protein

YLLGKRFLLVMDDVG

FPrintScan: PR00364
IPR000767
66-80 DISEASERSIST
Disease resistance protein

YLLGKRFLLVMDDVG

FPrintScan: PR00364
IPR000767
165-171 DISEASERSIST
Disease resistance protein

CGGLPLA

FPrintScan: PR00364
IPR000767
165-171 DISEASERSIST
Disease resistance protein

CGGLPLA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox