PRGDB00061908 (NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 240252412 (GQ203299)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza minuta

Comment?

Oryza minuta clone OM_Ba158E13_111D20, complete sequence.

DNA Sequence

ATGGCATCGGGGAAACTGCTTATTTTTCTTGCATTCCAAGTTGGGGGACAACTTTTGTTTTTCTTGTGCTCTTTCCATAAGACAACTACTAGGGCAGCTGCACGAAAGCCATCAGTTAAGATCTTCCGTCTTACCAAAATTACCAAGATTACCATGGCTCATAAGATGAAGAAGATGAAAGGTGAACTGAAGAATATCACAGATCAATATCAGAATTATGGATTCAAGCAAGGCTCTATCTCCAGTGAGCAACAAGTTCCTGATAAACGGGAAACATCATCTAAGGAGGAAGAAGAATTCATCATAGGAAGGACTGAAGAGAAGCAGACCTTTATATCTTCTTGTTTATCTGAAAACATCAACAAAAAGATCGTAATTCTCCCTATATATGGGATAGGAGGTATAGGCAAGACAATGTTTGCAAAAATGGTTTTCAACGATACCCAATTAAAAGACTACTCTCAGGTATGGATTTATGTGTCCCAGACATTTGACTTCAATAAAATTGGCAATTCTATAATATCAGAATTATCAAAAGAGGAGAGCAAATTGACAACAAGGCAGATGATACATACTTCCCTTGGAAAACCACTTGCTGACAAAATGATTTTGATTGTTTTAGATGATCTATGGGAGATTGATCAATTTGAATTAGACAAGTTGAAGACTATGCTAAATGTTGGTAATGCTAGGAAGGTGATTGTCATAGTAACCACCCGTGACAAAGAAATTGCATATAACATTTGTACAATTGAACCTTACAAGCTTCCACCCTTGACTGATGACATGTGTTGGACCATAATAAAACAGAAGGTTGACTTTGAAGCTAGACCTAACAATGATCAATTGGAGCTGGTAGGACGGGATATTGCATTAAAGTGCAGAGGGGTGGCATTAGCAGCTCAAGCACTAGGTTACATGTTGAGATCCATGACTTTTGATGAATGGGTATCAACTGTTGGAGTGCACTATGAGGATGTTACATTGTTGACCATGCATGACTTGCTGCATGACTTAGCAAGATATGTCATGGTTGATGAAATTCTAGATACTAGCAAACAAGGGAACACTGGGGAGAGCAGATGCCGCTTTGTATTGCTCAATGGCTGTACAGAGTCATTGAGGTCATTCACCCATTCTCCTACCAAGATTAGGGCTCTGCGTTATCTGGAAAGTGACAAAAATGTGCTCTGTGGTACTTCATCTGCTAAGTACCTGCGATTTCTTGTCCGTGGCAAAACTGGGTTTCACAATGATATGTTTTCATCTGCAAAATACCTGCATTTGTTGGATTTAAGCGAATGCTTTATACAGAAGTTGCCACATTCTATTGGTCAATTAAAGCAGTTGAGGTATCTTAGTGCTCCGGGGGTCCAAGATCGAAAGATTCTCAGTAGTATCACCAAGCTCTCAAAATTAATTTACCTCAACCTTCGTGGATCTGTAATTTCAGTACTGCAAGAATCAGTTAGAGAAATGGAAGGTGTATCAGAAACATTGGGGAACCTAACTCAATTGCGCTCTTTAAACTTGTCGAACTGCATAAACATTGGAGAGGTACCAGAAGATTTGGGCAGCCTCACGGACCTGAGATATTTGAACTTATCATGTAGCTCGTTTCTGACAAAGATGCCATATACGGGTGTTTTGGGCACCCTAACAAAGCTTGAATATTTGAACTTATCATCATTATCTTCAGATATCAAAAGGCTCCCTGATGCCATGGGGAGCTTCATTGAACTCAAATATTTAAACTTATCAGGTTGTAAATCAATAAAAGAGATACCAAAATCAATTGGGAAGCTTAGAAAGTTGGTTCATCTGGATTTATCTATGTGCTACAATGCTATTGGTATACCAGAAGTCTTGTGCAGCCTTACCAAACTCCAGTATTTGGATTTATCATGGTGCTTGATCGAATTACGTTATGGTGGACCGCCAAAAATGATGGATAAACTCATGGAGCTCCGATATTTGAATCTATCAGGATGTTTTGATCGTATCTCAAGGAACAACAGAGATCGTATCTCAAGGAACAACAGAATACGCCGTGCCGGACCTGAAACACCAACCATGGCTCAGTTCCCGACTTTGTCTACAAGATCATTACCCTTATGA


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Oryza minuta].

MASGKLLIFLAFQVGGQLLFFLCSFHKTTTRAAARKPSVKIFRLTKITKITMAHKMKKMKGELKNITDQYQNYGFKQGSISSEQQVPDKRETSSKEEEEFIIGRTEEKQTFISSCLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEWVSTVGVHYEDVTLLTMHDLLHDLARYVMVDEILDTSKQGNTGESRCRFVLLNGCTESLRSFTHSPTKIRALRYLESDKNVLCGTSSAKYLRFLVRGKTGFHNDMFSSAKYLHLLDLSECFIQKLPHSIGQLKQLRYLSAPGVQDRKILSSITKLSKLIYLNLRGSVISVLQESVREMEGVSETLGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGCFDRISRNNRDRISRNNRIRRAGPETPTMAQFPTLSTRSLPL

NBS-LRR disease resistance protein NBS-LRR disease resistance protein [Oryza minuta].

MASGKLLIFLAFQVGGQLLFFLCSFHKTTTRAAARKPSVKIFRLTKITKITMAHKMKKMKGELKNITDQYQNYGFKQGSISSEQQVPDKRETSSKEEEEFIIGRTEEKQTFISSCLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEWVSTVGVHYEDVTLLTMHDLLHDLARYVMVDEILDTSKQGNTGESRCRFVLLNGCTESLRSFTHSPTKIRALRYLESDKNVLCGTSSAKYLRFLVRGKTGFHNDMFSSAKYLHLLDLSECFIQKLPHSIGQLKQLRYLSAPGVQDRKILSSITKLSKLIYLNLRGSVISVLQESVREMEGVSETLGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGCFDRISRNNRDRISRNNRIRRAGPETPTMAQFPTLSTRSLPL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF270
38-670 PTHR23155:SF270,OS11G0211300 PROTEIN

SVKIFRLTKITKITMAHKMKKMKGELKNITDQYQNYGFKQGSISSEQQVPDKRETSSKEEEEFIIGRTEEKQTFISSCLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEWVSTVGVHYEDVTLLTMHDLLHDLARYVMVDEILDTSKQGNTGESRCRFVLLNGCTESLRSFTHSPTKIRALRYLESDKNVLCGTSSAKYLRFLVRGKTGFHNDMFSSAKYLHLLDLSECFIQKLPHSIGQLKQLRYLSAPGVQDRKILSSITKLSKLIYLNLRGSVISVLQESVREMEGVSETLGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGCFDRISR

HMMPanther: PTHR23155
38-670 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SVKIFRLTKITKITMAHKMKKMKGELKNITDQYQNYGFKQGSISSEQQVPDKRETSSKEEEEFIIGRTEEKQTFISSCLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEWVSTVGVHYEDVTLLTMHDLLHDLARYVMVDEILDTSKQGNTGESRCRFVLLNGCTESLRSFTHSPTKIRALRYLESDKNVLCGTSSAKYLRFLVRGKTGFHNDMFSSAKYLHLLDLSECFIQKLPHSIGQLKQLRYLSAPGVQDRKILSSITKLSKLIYLNLRGSVISVLQESVREMEGVSETLGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGCFDRISR

HMMPanther: PTHR23155:SF270
38-670 PTHR23155:SF270,OS11G0211300 PROTEIN

SVKIFRLTKITKITMAHKMKKMKGELKNITDQYQNYGFKQGSISSEQQVPDKRETSSKEEEEFIIGRTEEKQTFISSCLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEWVSTVGVHYEDVTLLTMHDLLHDLARYVMVDEILDTSKQGNTGESRCRFVLLNGCTESLRSFTHSPTKIRALRYLESDKNVLCGTSSAKYLRFLVRGKTGFHNDMFSSAKYLHLLDLSECFIQKLPHSIGQLKQLRYLSAPGVQDRKILSSITKLSKLIYLNLRGSVISVLQESVREMEGVSETLGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGCFDRISR

HMMPanther: PTHR23155
38-670 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SVKIFRLTKITKITMAHKMKKMKGELKNITDQYQNYGFKQGSISSEQQVPDKRETSSKEEEEFIIGRTEEKQTFISSCLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEWVSTVGVHYEDVTLLTMHDLLHDLARYVMVDEILDTSKQGNTGESRCRFVLLNGCTESLRSFTHSPTKIRALRYLESDKNVLCGTSSAKYLRFLVRGKTGFHNDMFSSAKYLHLLDLSECFIQKLPHSIGQLKQLRYLSAPGVQDRKILSSITKLSKLIYLNLRGSVISVLQESVREMEGVSETLGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGCFDRISR

superfamily: SSF52540
84-316 SSF52540

QQVPDKRETSSKEEEEFIIGRTEEKQTFISSCLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEW

superfamily: SSF52540
84-316 SSF52540

QQVPDKRETSSKEEEEFIIGRTEEKQTFISSCLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEW

HMMPfam: PF00931
IPR002182
115-320 NB-ARC,NBS
NB-ARC

CLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEWVSTV

HMMPfam: PF00931
IPR002182
115-320 NB-ARC,NBS
NB-ARC

CLSENINKKIVILPIYGIGGIGKTMFAKMVFNDTQLKDYSQVWIYVSQTFDFNKIGNSIISELSKEESKLTTRQMIHTSLGKPLADKMILIVLDDLWEIDQFELDKLKTMLNVGNARKVIVIVTTRDKEIAYNICTIEPYKLPPLTDDMCWTIIKQKVDFEARPNNDQLELVGRDIALKCRGVALAAQALGYMLRSMTFDEWVSTV

FPrintScan: PR00364
IPR000767
126-141 DISEASERSIST
Disease resistance protein

ILPIYGIGGIGKTMFA

FPrintScan: PR00364
IPR000767
126-141 DISEASERSIST
Disease resistance protein

ILPIYGIGGIGKTMFA

FPrintScan: PR00364
IPR000767
197-211 DISEASERSIST
Disease resistance protein

PLADKMILIVLDDLW

FPrintScan: PR00364
IPR000767
197-211 DISEASERSIST
Disease resistance protein

PLADKMILIVLDDLW

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

CRGVALAAQALGYML

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

CRGVALAAQALGYML

superfamily: SSF52058
376-664 SSF52058,LRR

SFTHSPTKIRALRYLESDKNVLCGTSSAKYLRFLVRGKTGFHNDMFSSAKYLHLLDLSECFIQKLPHSIGQLKQLRYLSAPGVQDRKILSSITKLSKLIYLNLRGSVISVLQESVREMEGVSETLGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGC

superfamily: SSF52058
376-664 SSF52058,LRR

SFTHSPTKIRALRYLESDKNVLCGTSSAKYLRFLVRGKTGFHNDMFSSAKYLHLLDLSECFIQKLPHSIGQLKQLRYLSAPGVQDRKILSSITKLSKLIYLNLRGSVISVLQESVREMEGVSETLGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGC

Gene3D: G3DSA:3.80.10.10
500-664 G3DSA:3.80.10.10

LGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGC

Gene3D: G3DSA:3.80.10.10
500-664 G3DSA:3.80.10.10

LGNLTQLRSLNLSNCINIGEVPEDLGSLTDLRYLNLSCSSFLTKMPYTGVLGTLTKLEYLNLSSLSSDIKRLPDAMGSFIELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLIELRYGGPPKMMDKLMELRYLNLSGC

FPrintScan: PR00364
IPR000767
501-517 DISEASERSIST
Disease resistance protein

GNLTQLRSLNLSNCINI

FPrintScan: PR00364
IPR000767
501-517 DISEASERSIST
Disease resistance protein

GNLTQLRSLNLSNCINI

HMMPfam: PF00560
IPR001611
505-527 LRR_1
Leucine-rich repeat

QLRSLNLSNCINIGEVPEDLGSL

HMMPfam: PF00560
IPR001611
505-527 LRR_1
Leucine-rich repeat

QLRSLNLSNCINIGEVPEDLGSL

HMMPfam: PF13855
580-639 LRR_8,Leucine rich repeat

ELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLI

HMMPfam: PF13855
580-639 LRR_8,Leucine rich repeat

ELKYLNLSGCKSIKEIPKSIGKLRKLVHLDLSMCYNAIGIPEVLCSLTKLQYLDLSWCLI


List of References

Jetty S S Ammiraju, Chuanzhu Fan, Yeisoo Yu, Xiang Song, Karen A Cranston, Ana Clara Pontaroli, Fei Lu, Abhijit Sanyal, Ning Jiang, Teri Rambo, Jennifer Currie, Kristi Collura, Jayson Talag, Jeffrey L Bennetzen, Mingsheng Chen, Scott Jackson, Rod A Wing
Spatio-temporal patterns of genome evolution in allotetraploid species of the genus Oryza.
Plant J.: 2010;
PubMed:20487382 WorldCat.org DOI (I a)

Jetty S S Ammiraju, Chuanzhu Fan, Yeisoo Yu, Xiang Song, Karen A Cranston, Ana Clara Pontaroli, Fei Lu, Abhijit Sanyal, Ning Jiang, Teri Rambo, Jennifer Currie, Kristi Collura, Jayson Talag, Jeffrey L Bennetzen, Mingsheng Chen, Scott Jackson, Rod A Wing
Spatio-temporal patterns of genome evolution in allotetraploid species of the genus Oryza.
Plant J.: 2010;
PubMed:20487382 WorldCat.org DOI (I a)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox