PRGDB00061912 (NBS-LRR disease resistance protein family-2)

From PRG Wiki
Jump to: navigation, search
NBS-LRR disease resistance protein family-2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 221327723 (FJ266021)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza brachyantha

Comment?

Oryza brachyantha clone OB__Ba045I08, complete sequence.

DNA Sequence

GCCACTGGAGTGCATCAAGAAAATGTCACGTTGTTAACCATGCACGACCTGGTGCATGATCTTGCAAGCTCGGTCATGGTGGATGAAATTCTGGTTTCCAGCAAACAAGATAACAATGATGAAAGCAGCTACCGATATGCATTGCTCAATGACAGCAGCAAGCCATTAGATTCATTCATCAAATTTGCTAACATGGTAAAAGCGCTGCGTTTTGTCGACTGTACTAAAACTAGACTTCATGATGGTGCATTTTCAGGTGCGAAGTACCTGCGTGTCTTGGATTTAAGCGAATGCTTTGTACAGAAGTTGCCAGATTATATCGGTCAGTTGAGGCAGCTGAGGTATCTTAGTGCTCCTGAGATCCAAGATGAAACTATTCCTGATTGTATAACCAAACTGTCAAAATTAATGTACCTCAATCTCCGTGGATCTTCGAAACTCAGATCGCTGCCAAAGTCTATTGGAGAAATGGATAGTCTGATGCATCTTGATTTATCAGGTTGTTCAGGAATACAAAGGGTACCACGATCATTTAGGGAGCTAAATTTGACGTATCTGGATTTGTCAAATTGCTTCAGCCTTAAGGGAGTATCAGAAATCTTGGGGAACCTCACCAAACTGCAACATTTGTGCCTATCATTTCGTCATGATATAGAGAAGCTAGGGAATTTGACTAGTCTGATGGAACAACAGTATTATCACATTTCAACCTCTTTTCCTCGAGGGCAGTGGCAAACACATGTTTTTCCTGCCAGGACTAGACTCGAACGTTTGAACATTTCAACAGAGCTCACATTTAGCGAAATCAAATGGCTTCCTGAAGCTACGAGCAGCTTCACTAAACTGAAGTATTTGAACTTATCTGGATGGATATGGCTGGAAGAATTACCAAGATCATGGGGGAATCTTCAAAATTTGATACATCTTGATGTATCATATTGTGTAAGGATTAAAGGTGTACCAGAAGCCTTGAGTAGCCTTACCAAACTCCAATATTTGAATTTGTCAAGATGCTGCCGGCAGAACAAAGAAGCCCTCAGAGGGCTCGAGGATGTGGTTGGCAAGCTCACCGAGCTTCGGTATTTCTATTTATCAAAATGCTTAGATACTCTCTTCTGTGAAATCGAAGTGGAGGGAGCGTGCCTAAATTTCCTTGCATCTCTCAGTTCCCTTTCCAATCTGGAGGAGCTGGACTTGTCTAATAATGACAGTATTGAAAGTTTACCTGAAAGCATTGGTGACCTGAGGAACCTGCAAACGCTTAACCTCTCGTGCTGCTGGAATCTCTCTCACCTTCCAACGATTATAAGCAAGATGGATAGTCTGAAGCATCTAAATCTGTCTGGCTGTGACAGGTTGGACAAGTCCACGGTACCTAAGTTTGACAGTAGTTCAATCTTGTTACCACAATTTGAGATCCAACCCTGCGACGGTGAATCTAGCAGCAACCTTGTTCTGCTTCAGGATGTAGATAGTACTACTGAGCTGGAGATAAGTAAACTGGAAAACGTGGCCACTGTCGAAGAGGCAGCGAGAGTAAGGTTGAAGGAGAAAGAAATGATCGAAGAACTGGCGCTCGAGTGGACGAGAGATTTGAGGAGATTTGTCGAGGATCGGGACCTGTTGGGAGAGTTAGAGCCACCAAGTAAGCTGAAATGGTTCAAGCTACAAGGTTACAGCAGTGTAGCCTTCCCAGACTGGCTGATGAACGCTAGTCATCTTCACCATTTCGCTTGCCTCAAGAGGATTGATCTGGTGGATTTGCCCAGGTGCACCCGCCTCCCACTGCTCGGCCAGCTGCCAGGACTGAAAACTCTCTCGCTCGATCGAATGAACGGCATCACCAAGATCGACGGCGAGTTCTACGGCGGAGCGGGAGCATTTCGCCAGCTGAGGAACCTGTCCATGTCCAACATGGAGAACCTGGAGACGTGGCAAACGACGTACAGTACCTGCGGCAATGGCGAAGGCGCGGCTGTGCTCAAGCGCCTCAGACTGTATGAACTGGAAATCCATCACTGCCCCAAGCTGAGCATCACACCATGCCCCCCTGAAGCCGTTCGCTGGGAGGTCGAGGGCAGCGACGGCGTGCTGTCGTCATGGCCGAACACCTGCGCTTCGTCGTCCTCCGCCGTTGTCCGAGCAGACGAACTGACCGTCAAGCTCTGCAAGCTGCCATTGCGTCAGTGGAGGTTGCTCCATCAGCTGACTCCCCTGAAATGTCTGACCATCGATTCATGCACTGATCTGAGCAGCTCACCGGAGATCACTCGAGCCCTATCCACCCTCCGAACGCTCTCCCTGAAAGGAAACGACGGTGACCCAGAACTGCCCAGCTGGATAGGAGAGCTCACGCGTCTTCCCGAGCTACGTGTAACCACTCGGTGGCCGGAGCTGACAGTAAACCGTGGGATGATGAGACAGCTTTCCTCTTTACGGTGTCTTATTCTGTCTGAATGTGCAAGAATGACGTCGTTGCCGGATTGGTTGGAGGATCTGCCCTCTCTGCGTGATCTCAGGATAGAATCCTGCGCAGGCCTGAGCAGTCTGGAAGGAGGGAGCATGGAGCGCCTCACGTCGCTCAAGTGGCTAGCGTTGAGCTGCTGCCCGAGCATTGCAGCGCTGCCGGAGAGCTTGGGCGAGCTCACTTCGCTGACGTATCTTGGGATCTTCGAGTGCCCCAACATCAAATTTCTGCCGGAGAGCATTCAGAGACTTACCAATTTGAATACTCTGACGGTTTCTGCGTGCCCTGAACTGAAGAAGTGGTGCCAGTCGAAGAACAGGACCGTGCTCTCTCGCGTGCCCTACAAGACCTACGAGTAAATGAAAAAGCTGAGAGGGGAATTAGAGAAGATCACTAAACAACACAAGGACTTCTCATTCAGTTCAGACAGTAGCTCCAACATACAGCAGGAAACTTACAGTGATAGGAGAACATCACCGAAGGTTGAAGAAGCAGCCATCGTAGGAAGGACTCAAGAGAAGCAGAAATTACTAGATTGTTTATCTGATAAGGTCTTGATGAAAGATTTCATTATCCTTGCGATATATGGCATGGGAGGGATTGGCAAGACAACCTTAGCACAATTAGTTTTCAATGATAAACAATTTAAAGAGTATGCACCTGCGTGGGTCCATGTGTCACAAGTGTTTGACTTGGACAAAATTGAGAACTCTATAATTTCGCAACTCTCCAAAAGGGATCCCAGTGTGACTCATTTGGAGATGGTTCCTCCTAATATGAACATTATAATCGTTTTGGATGATCTTTGGGAGAATGATGGTTTTAAATTGGATAATTTGAAGCTTAGGCTAAAAGTTGGCAAGGGAACCAAGGTGATTGTCATTGTTACCACACGCCATAAGAGCATTGCTAATAGATTTTCCACTGTTCAACCATACTTGCTGGAGCCGTTGACTGATGACATGTGTTGGAAGATAATAAAACAAAAAAGTGCCTTCGAAGATAGACATGACAAAGAATTGTTGGAACAGACAGGAATGGAGATTGCAACGAAGTGTGGAGGTGTGGCATTAGCAGCTCTATCCGTTGGGTACATGTTACATTCCAAAAAGGTGGATGAATGGGAGTCAGTCAGAGACAGCGATATTTGGAATGAATCTGCCTCAGAAGATACATCTTCACCACATCATGTTCTTTCATCCTTGAAGTTAAGTTATGTCAGAATGAATCCATGCTTAAAGATGTGTTTTGGCTACTGTGCAATCTTTCAGAAAGGCCAAAAGATAGTTAAGGATGATTTAATTCATCAATGGATTTGCCTGGATTTTATTGAGCCATCAAAGGTATACTCCTCTAGGCAGCTTGGTGAGATATATGTTACTGAGCTTTTGGGAATGTCATTTCTTCAACATTCAAAGTCATCGTCG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein family-2 NBS-LRR disease resistance protein family-2 [Oryza brachyantha].

MKKLRGELEKITKQHKDFSFSSDSSSNIQQETYSDRRTSPKVEEAAIVGRTQEKQKLLDCLSDKVLMKDFIILAIYGMGGIGKTTLAQLVFNDKQFKEYAPAWVHVSQVFDLDKIENSIISQLSKRDPSVTHLEMVPPNMNIIIVLDDLWENDGFKLDNLKLRLKVGKGTKVIVIVTTRHKSIANRFSTVQPYLLEPLTDDMCWKIIKQKSAFEDRHDKELLEQTGMEIATKCGGVALAALSVGYMLHSKKVDEWESVRDSDIWNESASEDTSSPHHVLSSLKLSYVRMNPCLKMCFGYCAIFQKGQKIVKDDLIHQWICLDFIEPSKVYSSRQLGEIYVTELLGMSFLQHSKSSSATGVHQENVTLLTMHDLVHDLASSVMVDEILVSSKQDNNDESSYRYALLNDSSKPLDSFIKFANMVKALRFVDCTKTRLHDGAFSGAKYLRVLDLSECFVQKLPDYIGQLRQLRYLSAPEIQDETIPDCITKLSKLMYLNLRGSSKLRSLPKSIGEMDSLMHLDLSGCSGIQRVPRSFRELNLTYLDLSNCFSLKGVSEILGNLTKLQHLCLSFRHDIEKLGNLTSLMEQQYYHISTSFPRGQWQTHVFPARTRLERLNISTELTFSEIKWLPEATSSFTKLKYLNLSGWIWLEELPRSWGNLQNLIHLDVSYCVRIKGVPEALSSLTKLQYLNLSRCCRQNKEALRGLEDVVGKLTELRYFYLSKCLDTLFCEIEVEGACLNFLASLSSLSNLEELDLSNNDSIESLPESIGDLRNLQTLNLSCCWNLSHLPTIISKMDSLKHLNLSGCDRLDKSTVPKFDSSSILLPQFEIQPCDGESSSNLVLLQDVDSTTELEISKLENVATVEEAARVRLKEKEMIEELALEWTRDLRRFVEDRDLLGELEPPSKLKWFKLQGYSSVAFPDWLMNASHLHHFACLKRIDLVDLPRCTRLPLLGQLPGLKTLSLDRMNGITKIDGEFYGGAGAFRQLRNLSMSNMENLETWQTTYSTCGNGEGAAVLKRLRLYELEIHHCPKLSITPCPPEAVRWEVEGSDGVLSSWPNTCASSSSAVVRADELTVKLCKLPLRQWRLLHQLTPLKCLTIDSCTDLSSSPEITRALSTLRTLSLKGNDGDPELPSWIGELTRLPELRVTTRWPELTVNRGMMRQLSSLRCLILSECARMTSLPDWLEDLPSLRDLRIESCAGLSSLEGGSMERLTSLKWLALSCCPSIAALPESLGELTSLTYLGIFECPNIKFLPESIQRLTNLNTLTVSACPELKKWCQSKNRTVLSRVPYKTYE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-1293 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MKKLRGELEKITKQHKDFSFSSDSSSNIQQETYSDRRTSPKVEEAAIVGRTQEKQKLLDCLSDKVLMKDFIILAIYGMGGIGKTTLAQLVFNDKQFKEYAPAWVHVSQVFDLDKIENSIISQLSKRDPSVTHLEMVPPNMNIIIVLDDLWENDGFKLDNLKLRLKVGKGTKVIVIVTTRHKSIANRFSTVQPYLLEPLTDDMCWKIIKQKSAFEDRHDKELLEQTGMEIATKCGGVALAALSVGYMLHSKKVDEWESVRDSDIWNESASEDTSSPHHVLSSLKLSYVRMNPCLKMCFGYCAIFQKGQKIVKDDLIHQWICLDFIEPSKVYSSRQLGEIYVTELLGMSFLQHSKSSSATGVHQENVTLLTMHDLVHDLASSVMVDEILVSSKQDNNDESSYRYALLNDSSKPLDSFIKFANMVKALRFVDCTKTRLHDGAFSGAKYLRVLDLSECFVQKLPDYIGQLRQLRYLSAPEIQDETIPDCITKLSKLMYLNLRGSSKLRSLPKSIGEMDSLMHLDLSGCSGIQRVPRSFRELNLTYLDLSNCFSLKGVSEILGNLTKLQHLCLSFRHDIEKLGNLTSLMEQQYYHISTSFPRGQWQTHVFPARTRLERLNISTELTFSEIKWLPEATSSFTKLKYLNLSGWIWLEELPRSWGNLQNLIHLDVSYCVRIKGVPEALSSLTKLQYLNLSRCCRQNKEALRGLEDVVGKLTELRYFYLSKCLDTLFCEIEVEGACLNFLASLSSLSNLEELDLSNNDSIESLPESIGDLRNLQTLNLSCCWNLSHLPTIISKMDSLKHLNLSGCDRLDKSTVPKFDSSSILLPQFEIQPCDGESSSNLVLLQDVDSTTELEISKLENVATVEEAARVRLKEKEMIEELALEWTRDLRRFVEDRDLLGELEPPSKLKWFKLQGYSSVAFPDWLMNASHLHHFACLKRIDLVDLPRCTRLPLLGQLPGLKTLSLDRMNGITKIDGEFYGGAGAFRQLRNLSMSNMENLETWQTTYSTCGNGEGAAVLKRLRLYELEIHHCPKLSITPCPPEAVRWEVEGSDGVLSSWPNTCASSSSAVVRADELTVKLCKLPLRQWRLLHQLTPLKCLTIDSCTDLSSSPEITRALSTLRTLSLKGNDGDPELPSWIGELTRLPELRVTTRWPELTVNRGMMRQLSSLRCLILSECARMTSLPDWLEDLPSLRDLRIESCAGLSSLEGGSMERLTSLKWLALSCCPSIAALPESLGELTSLTYLGIFECPNIKFLPESIQRLTNLNTLTVSACPELKKWCQSKNRTVLSRVPY

HMMPanther: PTHR23155:SF270
1-1293 PTHR23155:SF270,OS11G0211300 PROTEIN

MKKLRGELEKITKQHKDFSFSSDSSSNIQQETYSDRRTSPKVEEAAIVGRTQEKQKLLDCLSDKVLMKDFIILAIYGMGGIGKTTLAQLVFNDKQFKEYAPAWVHVSQVFDLDKIENSIISQLSKRDPSVTHLEMVPPNMNIIIVLDDLWENDGFKLDNLKLRLKVGKGTKVIVIVTTRHKSIANRFSTVQPYLLEPLTDDMCWKIIKQKSAFEDRHDKELLEQTGMEIATKCGGVALAALSVGYMLHSKKVDEWESVRDSDIWNESASEDTSSPHHVLSSLKLSYVRMNPCLKMCFGYCAIFQKGQKIVKDDLIHQWICLDFIEPSKVYSSRQLGEIYVTELLGMSFLQHSKSSSATGVHQENVTLLTMHDLVHDLASSVMVDEILVSSKQDNNDESSYRYALLNDSSKPLDSFIKFANMVKALRFVDCTKTRLHDGAFSGAKYLRVLDLSECFVQKLPDYIGQLRQLRYLSAPEIQDETIPDCITKLSKLMYLNLRGSSKLRSLPKSIGEMDSLMHLDLSGCSGIQRVPRSFRELNLTYLDLSNCFSLKGVSEILGNLTKLQHLCLSFRHDIEKLGNLTSLMEQQYYHISTSFPRGQWQTHVFPARTRLERLNISTELTFSEIKWLPEATSSFTKLKYLNLSGWIWLEELPRSWGNLQNLIHLDVSYCVRIKGVPEALSSLTKLQYLNLSRCCRQNKEALRGLEDVVGKLTELRYFYLSKCLDTLFCEIEVEGACLNFLASLSSLSNLEELDLSNNDSIESLPESIGDLRNLQTLNLSCCWNLSHLPTIISKMDSLKHLNLSGCDRLDKSTVPKFDSSSILLPQFEIQPCDGESSSNLVLLQDVDSTTELEISKLENVATVEEAARVRLKEKEMIEELALEWTRDLRRFVEDRDLLGELEPPSKLKWFKLQGYSSVAFPDWLMNASHLHHFACLKRIDLVDLPRCTRLPLLGQLPGLKTLSLDRMNGITKIDGEFYGGAGAFRQLRNLSMSNMENLETWQTTYSTCGNGEGAAVLKRLRLYELEIHHCPKLSITPCPPEAVRWEVEGSDGVLSSWPNTCASSSSAVVRADELTVKLCKLPLRQWRLLHQLTPLKCLTIDSCTDLSSSPEITRALSTLRTLSLKGNDGDPELPSWIGELTRLPELRVTTRWPELTVNRGMMRQLSSLRCLILSECARMTSLPDWLEDLPSLRDLRIESCAGLSSLEGGSMERLTSLKWLALSCCPSIAALPESLGELTSLTYLGIFECPNIKFLPESIQRLTNLNTLTVSACPELKKWCQSKNRTVLSRVPY

superfamily: SSF52540
30-264 SSF52540

QETYSDRRTSPKVEEAAIVGRTQEKQKLLDCLSDKVLMKDFIILAIYGMGGIGKTTLAQLVFNDKQFKEYAPAWVHVSQVFDLDKIENSIISQLSKRDPSVTHLEMVPPNMNIIIVLDDLWENDGFKLDNLKLRLKVGKGTKVIVIVTTRHKSIANRFSTVQPYLLEPLTDDMCWKIIKQKSAFEDRHDKELLEQTGMEIATKCGGVALAALSVGYMLHSKKVDEWESVRDSDIW

Gene3D: G3DSA:3.40.50.300
39-182 G3DSA:3.40.50.300

SPKVEEAAIVGRTQEKQKLLDCLSDKVLMKDFIILAIYGMGGIGKTTLAQLVFNDKQFKEYAPAWVHVSQVFDLDKIENSIISQLSKRDPSVTHLEMVPPNMNIIIVLDDLWENDGFKLDNLKLRLKVGKGTKVIVIVTTRHKS

HMMPfam: PF00931
IPR002182
51-328 NB-ARC,NBS
NB-ARC

TQEKQKLLDCLSDKVLMKDFIILAIYGMGGIGKTTLAQLVFNDKQFKEYAPAWVHVSQVFDLDKIENSIISQLSKRDPSVTHLEMVPPNMNIIIVLDDLWENDGFKLDNLKLRLKVGKGTKVIVIVTTRHKSIANRFSTVQPYLLEPLTDDMCWKIIKQKSAFEDRHDKELLEQTGMEIATKCGGVALAALSVGYMLHSKKVDEWESVRDSDIWNESASEDTSSPHHVLSSLKLSYVRMNPCLKMCFGYCAIFQKGQKIVKDDLIHQWICLDFIEPSK

FPrintScan: PR00364
IPR000767
72-87 DISEASERSIST
Disease resistance protein

ILAIYGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
136-150 DISEASERSIST
Disease resistance protein

VPPNMNIIIVLDDLW

FPrintScan: PR00364
IPR000767
233-247 DISEASERSIST
Disease resistance protein

CGGVALAALSVGYML

superfamily: SSF52058
369-858 SSF52058,LRR

TMHDLVHDLASSVMVDEILVSSKQDNNDESSYRYALLNDSSKPLDSFIKFANMVKALRFVDCTKTRLHDGAFSGAKYLRVLDLSECFVQKLPDYIGQLRQLRYLSAPEIQDETIPDCITKLSKLMYLNLRGSSKLRSLPKSIGEMDSLMHLDLSGCSGIQRVPRSFRELNLTYLDLSNCFSLKGVSEILGNLTKLQHLCLSFRHDIEKLGNLTSLMEQQYYHISTSFPRGQWQTHVFPARTRLERLNISTELTFSEIKWLPEATSSFTKLKYLNLSGWIWLEELPRSWGNLQNLIHLDVSYCVRIKGVPEALSSLTKLQYLNLSRCCRQNKEALRGLEDVVGKLTELRYFYLSKCLDTLFCEIEVEGACLNFLASLSSLSNLEELDLSNNDSIESLPESIGDLRNLQTLNLSCCWNLSHLPTIISKMDSLKHLNLSGCDRLDKSTVPKFDSSSILLPQFEIQPCDGESSSNLVLLQDVDSTTELEISKLE

Gene3D: G3DSA:3.80.10.10
423-613 G3DSA:3.80.10.10

KALRFVDCTKTRLHDGAFSGAKYLRVLDLSECFVQKLPDYIGQLRQLRYLSAPEIQDETIPDCITKLSKLMYLNLRGSSKLRSLPKSIGEMDSLMHLDLSGCSGIQRVPRSFRELNLTYLDLSNCFSLKGVSEILGNLTKLQHLCLSFRHDIEKLGNLTSLMEQQYYHISTSFPRGQWQTHVFPARTRLER

ProfileScan: PS51450
IPR001611
445-466 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLRVLDLSECFVQKLPDYIGQL

HMMPfam: PF00560
IPR001611
446-465 LRR_1
Leucine-rich repeat

LRVLDLSECFVQKLPDYIGQ

HMMPfam: PF13855
490-547 LRR_8,Leucine rich repeat

SKLMYLNLRGSSKLRSLPKSIGEMDSLMHLDLSGCSGIQRVPRSFRELNLTYLDLSNC

ProfileScan: PS51450
IPR001611
538-560 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTYLDLSNCFSLKGVSEILGNL

ProfileScan: PS51450
IPR001611
562-584 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQHLCLSFRHDIEKLGNLTSLM

Gene3D: G3DSA:3.80.10.10
614-723 G3DSA:3.80.10.10

LNISTELTFSEIKWLPEATSSFTKLKYLNLSGWIWLEELPRSWGNLQNLIHLDVSYCVRIKGVPEALSSLTKLQYLNLSRCCRQNKEALRGLEDVVGKLTELRYFYLSKC

HMMPfam: PF13855
637-694 LRR_8,Leucine rich repeat

KLKYLNLSGWIWLEELPRSWGNLQNLIHLDVSYCVRIKGVPEALSSLTKLQYLNLSRC

ProfileScan: PS51450
IPR001611
661-684 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLIHLDVSYCVRIKGVPEALSSLT

ProfileScan: PS51450
IPR001611
685-706 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQYLNLSRCCRQNKEALRGLE

Gene3D: G3DSA:3.80.10.10
737-815 G3DSA:3.80.10.10

CLNFLASLSSLSNLEELDLSNNDSIESLPESIGDLRNLQTLNLSCCWNLSHLPTIISKMDSLKHLNLSGCDRLDKSTVP

FPrintScan: PR00364
IPR000767
745-761 DISEASERSIST
Disease resistance protein

SSLSNLEELDLSNNDSI

HMMPfam: PF13855
748-806 LRR_8,Leucine rich repeat

SNLEELDLSNNDSIESLPESIGDLRNLQTLNLSCCWNLSHLPTIISKMDSLKHLNLSGC

ProfileScan: PS51450
IPR001611
749-771 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELDLSNNDSIESLPESIGDL

ProfileScan: PS51450
IPR001611
773-795 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLNLSCCWNLSHLPTIISKM

Gene3D: G3DSA:3.80.10.10
898-1010 G3DSA:3.80.10.10

LGELEPPSKLKWFKLQGYSSVAFPDWLMNASHLHHFACLKRIDLVDLPRCTRLPLLGQLPGLKTLSLDRMNGITKIDGEFYGGAGAFRQLRNLSMSNMENLETWQTTYSTCGN

superfamily: SSF52058
898-1297 SSF52058,LRR

LGELEPPSKLKWFKLQGYSSVAFPDWLMNASHLHHFACLKRIDLVDLPRCTRLPLLGQLPGLKTLSLDRMNGITKIDGEFYGGAGAFRQLRNLSMSNMENLETWQTTYSTCGNGEGAAVLKRLRLYELEIHHCPKLSITPCPPEAVRWEVEGSDGVLSSWPNTCASSSSAVVRADELTVKLCKLPLRQWRLLHQLTPLKCLTIDSCTDLSSSPEITRALSTLRTLSLKGNDGDPELPSWIGELTRLPELRVTTRWPELTVNRGMMRQLSSLRCLILSECARMTSLPDWLEDLPSLRDLRIESCAGLSSLEGGSMERLTSLKWLALSCCPSIAALPESLGELTSLTYLGIFECPNIKFLPESIQRLTNLNTLTVSACPELKKWCQSKNRTVLSRVPYKTYE

ProfileScan: PS51450
IPR001611
958-980 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLKTLSLDRMNGITKIDGEFYGG

Gene3D: G3DSA:3.80.10.10
1085-1274 G3DSA:3.80.10.10

QWRLLHQLTPLKCLTIDSCTDLSSSPEITRALSTLRTLSLKGNDGDPELPSWIGELTRLPELRVTTRWPELTVNRGMMRQLSSLRCLILSECARMTSLPDWLEDLPSLRDLRIESCAGLSSLEGGSMERLTSLKWLALSCCPSIAALPESLGELTSLTYLGIFECPNIKFLPESIQRLTNLNTLTVSACP

HMMPfam: PF13855
1166-1225 LRR_8,Leucine rich repeat

SSLRCLILSECARMTSLPDWLEDLPSLRDLRIESCAGLSSLEGGSMERLTSLKWLALSCC

ProfileScan: PS51450
IPR001611
1167-1190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRCLILSECARMTSLPDWLEDLP


List of References

Jetty S S Ammiraju, Fei Lu, Abhijit Sanyal, Yeisoo Yu, Xiang Song, Ning Jiang, Ana Clara Pontaroli, Teri Rambo, Jennifer Currie, Kristi Collura, Jayson Talag, Chuanzhu Fan, Jose Luis Goicoechea, Andrea Zuccolo, Jinfeng Chen, Jeffrey L Bennetzen, Mingsheng Chen, Scott Jackson, Rod A Wing
Dynamic evolution of oryza genomes is revealed by comparative genomic analysis of a genus-wide vertical data set.
Plant Cell: 2008, 20(12);3191-209
PubMed:19098269 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox