PRGDB00061914 (NBS-LRR disease resistance protein family-3)

From PRG Wiki
Jump to: navigation, search
NBS-LRR disease resistance protein family-3
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 221327723 (FJ266021)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza brachyantha

Comment?

Oryza brachyantha clone OB__Ba045I08, complete sequence.

DNA Sequence

ATGGCGGAAGTCGGAGGGCTGCTCGCCTCCGCCGTCCTCAAGTTGGCCGCCCAAAAGATGGGCTCCGCCATCGGCGGCCAGATCCTGCTGCACTCGAACTTCCACAGCGACCTGCGGGAGATGAAGATGACGCTCGAATCCGTGGAGGCGCTGCTCAACGACGCAGAGAGGCAGTCCATCGACAGGGAATCGGTGCGGCTCTGGCTGCAGCGGCTCAAGCACTGCTCCTACGACATCGCCGACATGCTCGACGAGGTCGAGGCAAGGACAAATCCGGCAGCGGCCACGGTATCTCTTATTCCTAAGATTATAATGGCTAATAAGATGAAGATGATGAGAACGAAATTGGTGAAGATCACTAATTTACACAAGGATTTTGGATTAACAGAAAGTGTTAGCTGCAATGTACAGCAAGTTACTGACCCACGTGCATCTGCGTCCAAAGTGGAAGAAGCATTCATAGTAGGAAGAACCAAGGAGAAACAAAAAGTAATAACAATTCTATCAGAAGCCAGCACTTGGCAAGGCACCACAATCCTTCCGATATATGGTATCGGAGGGATAGGCAAGACAACCTTGGCAAAATTGGTTTTCAACGACACTGGTTTCAAAGACTATTTTCAGGCATGGGTCTATATTTCGCAGACATTTGACTTGAATAAAATTTGCAACTCTATAATTTCACAAATTTCTGGTCATGAGAACATGATGACTGAAAAGCAGATGATAAACAGACGACTTGAAGAGCTGCTTGCAGGTAGGAAGGTTCTGGTGGTTCTAGATGACTTATGGGAGAAAGGTGGATCTGAGTTAGATGAATTGAAGCTTATGCTTAAGGCTGGTGAGAACAGCGATATCATTGTTATAGTAACCACTCGCGATGAAGGCATTGCCAAGAAAATTTGCACAGTTCAGCCATACAAGCTGGAGCCCTTAACAGACAACATGTGCTGGAAAATAATAAAACAAAAAAGTGCATTCAATGATAGGGATGACAAAAGACAGTTGGAGCCGATAGGAAGGGACATTGCAAAGAAGTGTGGAGGTGTGGCTTTAGCAGCCCAATCCCTTGGATACATATTACAGTCCATGACATCTGATGAATGGGTATCAGTGAGAAACAGTGATATCTGGAGTAAATCTACTTCAAAGGGTAGATCTTTGCCACACCACAATGTGCTTGCATCCTTACTTTTAAGCTACAGCAATATGTTGCCATATTTGAGGTTGTGCTTTGCTTACTGTGCTATCTTTCCCAAAGGTTACAAGATAGTTCAGGATGATTTAATTCAACAATGGATTGCTCTTGATTTGATTGAACCATCTGATATATTCTCTGTGAGGCAGCTCAGTAAGAATTATATTTCACAGCTGTTGGGGATGTCCTTTCTTCAGCATTCAAAGGCGCCTTCAGTGATGCTTTATAAGATGCTTTTCCTGCAGACAGTTGGACTGCATTATGAAGATGTTACATTGTTTACTATGCATGACTTGGTGCATGAAGTTGCAAGATCAATCATGGTGGATGAAGTTTTGTACTCTAGGAAAGAAGGCAATATTGCAGGAACCAACTGCCGCTATGCTTTGCTCGAAGATTGTAGCAAGCCATTAGAATTATTGACTACCACACCTAACAAGATAAGGGCTCTACATTTTTTGGACTGTGCTAAAATTGTGCCTCGTGGTACTGCATTTTCATCCGCTACGTGCCTACGAGTTCTTGATTTAAGCGAATGTTATGTACATAAGTTGCCAGATTCTATTGGTCAAATGAAGCAGTTGAGGTACCTAAAAGCCCCCGATATTAAGGATCAAACAATCACCAAGTGCATCACCAAGCTCTCAAAATTAAGCTATCTTAACCTTTCCAGATCTCAGAGAGTTCTTGTCTTGCCAAAGTCAATTGGAAGAATGGAATGTCTGATGCATCTTGATTTGTCGTGGTGTTCGCAAATAGGAGAACTGCCAATATCATTTGGGAAGCTCAAGAAATTAGCACATCTAAATTTGTCAAATTGTTCTGAGGTTAGTGGTGTTTCAGAATCCCTGGGGAGCCTTACGCAACTGCAATATTTGAACTTATCATACTGCAGAAAAATTGGAGAACTTCCCCAAAATTTGGGTAAGCTCGTGGGACTGCAATATTTGAACTTGTCATGCAGCTCATATCTTGACGGGCTTCCAACTACAGAAGTGTTGAGCACCCTTACTAAACTTGAATACTTGAACTTATCTTCAGAACTCTCGTATATTGGAAAGCTCCCTGAAGCTTTGGGATGCTTCACTGAACTCAAATATTTAAACTTGTCAGGGTGTCGTGGAATTGATGAATTGCCGAAGTCGTTTGGGAACCTCAGAAATTTGGTTCATCTGGATTTCTCTAAATGTTATCGTGTTGGGCGAATTGCAGAAGCTTTGCACGGCCTTACCAAACTCCAGTACCTGAATTTGTCGTCTTGCTGTTATGGCAATCAGTTGCATCTCAAAGGGCTACCAGAAGTTATAAGAAATCTTACTGAACTCCGGTATTTAAATTTATCAATGTGCCTCGATGCTATCTTTGATCGCAAATCAGCTGGTGAAAATCAAACATCTGTTGAATTCATCAGTAATTTGGCCAATCTAGAGCATCTAGATTTGTCTAAAAATATCAGTCTTTCTAGTTTGCCTGAAAGTCTTGGTAGCCTCCGAAAGCTACATACGCTGGACCTTTCAGGCTGCAGCAGATTGGAGAGGGTACCCGAAAGTATAGCTACAATTGATAGTCTAAAATTTCTAATTGTTATGAACTGCTGGAAGCTTGATAGGTTTAGGCTTTCTCGGTTCAATGACAATTCAATCTTATTGCCACACTTTATGGTTCAAGCTGGTGATGGTGAATCTAGCAGCAATCTTGTTCAGCTTCAGGATGCCAATCCCGCTGAGTTGGAAATAAATAACCTTGAAAATGTAAAGTTTGCCAAAGATGCACAAATAATAAAGTTGTTGCAAAAACAAAGGATCTTAAAATTGAAACTTCAATGGACTACTGGTTCTAGAAGATATGCGGAGGACATGGAGGTGCTGAAAGAGCTGCTGCCATCCAGTACTTTGGAGCACTTTGAAATACGAGGTTATAACAGTACAAGTTTTCCAGGTTGGTTAATTGGCATTTCCTCTTATCTCCCTAATCTTGTTGAAATTAAGATGGTGGACTTGATAATGTGCGAAAACCTACCTCCACTTGGTCAATTACCCAACCTACAGGAGTTGGTCCTTCAAAAAATGCCCGCCATTAAGAAAATTGATGCAGACCTGTGCGGTGGGGCAAGATCATTTCCTAGCCTAAGGAAATTTATTCTATCAGACATGGAGAACCTGGAAGAGTGGAGCACAACATACTCCTGTGGTGAGAGTTTTGTGAATCAGTTCATGTTCCCTAACCTTCAGGTATTGGAAACACGTGATTGCCCAAAGTTGAGGCTGAAGCCCTGCCCTCCTAGAGCTGTTAAGTGGGATATTTGGAGCAGTGACAATGCAATATTATCATGGGGGGAGAGAGAGACAAGATCCTCTGCTGATTCCACCATCTCATGTCCAGTTTCTTATCTCGTGGTTATTTTCTGCAAGGTTCCTTTGCATCAGTGGAGATTGCTTCACCACCTCCCGTCACTGCCTAGTTTAAGCATAAACAGTTGCAACGATTTGACCAGCTCACCAGAGATCAGTCAGGAATTATCCTCCCTGCGATATTTGACTCTACATGGTAACTATGAAGCAGAGCTGCCAAAATGGTTGGGTGAGCTAACATCACTTCAGCAGCTGTGGATAAGTAGCAAATATCCGGAGCTAAAGGCATCACAGGAGAGCATCGCGCAGCTGACTTCATTACAGTCGCTTTATTTGACCTCATGTGAGACCATAGAAACACTGCCACAATGGTTGGGCGTTCTCACGTCTCTCCAAGATTTAGGGATCTCACACTGTCCAAAGCTAACTAATTTACATGGTACCATGCGACTGCGCTCTCTCCGTTCGCTGCATTTGAGTTATTGCGGAAGCATTGTACATCTCCCAGAAGGGTTGGGGAACCTTACTGCGCTCACTGAACTTAGTATCTGGAACTGTGGGGGCATCAAGTTTTTGCCGGAGAGCATACGCCACCTTACTAACCTCTTCATTCTAGATATTGCAGCCTGTCCTGAACTGAAGTCGTGGTGTGCATCAGATGAGAACGTGATGAAGCTGGCTCACATAGAAAGAAAAGTACGTATCCTGCCAAACCCATCTTCATATTAG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein family-3 NBS-LRR disease resistance protein family-3 [Oryza brachyantha].

MAEVGGLLASAVLKLAAQKMGSAIGGQILLHSNFHSDLREMKMTLESVEALLNDAERQSIDRESVRLWLQRLKHCSYDIADMLDEVEARTNPAAATVSLIPKIIMANKMKMMRTKLVKITNLHKDFGLTESVSCNVQQVTDPRASASKVEEAFIVGRTKEKQKVITILSEASTWQGTTILPIYGIGGIGKTTLAKLVFNDTGFKDYFQAWVYISQTFDLNKICNSIISQISGHENMMTEKQMINRRLEELLAGRKVLVVLDDLWEKGGSELDELKLMLKAGENSDIIVIVTTRDEGIAKKICTVQPYKLEPLTDNMCWKIIKQKSAFNDRDDKRQLEPIGRDIAKKCGGVALAAQSLGYILQSMTSDEWVSVRNSDIWSKSTSKGRSLPHHNVLASLLLSYSNMLPYLRLCFAYCAIFPKGYKIVQDDLIQQWIALDLIEPSDIFSVRQLSKNYISQLLGMSFLQHSKAPSVMLYKMLFLQTVGLHYEDVTLFTMHDLVHEVARSIMVDEVLYSRKEGNIAGTNCRYALLEDCSKPLELLTTTPNKIRALHFLDCAKIVPRGTAFSSATCLRVLDLSECYVHKLPDSIGQMKQLRYLKAPDIKDQTITKCITKLSKLSYLNLSRSQRVLVLPKSIGRMECLMHLDLSWCSQIGELPISFGKLKKLAHLNLSNCSEVSGVSESLGSLTQLQYLNLSYCRKIGELPQNLGKLVGLQYLNLSCSSYLDGLPTTEVLSTLTKLEYLNLSSELSYIGKLPEALGCFTELKYLNLSGCRGIDELPKSFGNLRNLVHLDFSKCYRVGRIAEALHGLTKLQYLNLSSCCYGNQLHLKGLPEVIRNLTELRYLNLSMCLDAIFDRKSAGENQTSVEFISNLANLEHLDLSKNISLSSLPESLGSLRKLHTLDLSGCSRLERVPESIATIDSLKFLIVMNCWKLDRFRLSRFNDNSILLPHFMVQAGDGESSSNLVQLQDANPAELEINNLENVKFAKDAQIIKLLQKQRILKLKLQWTTGSRRYAEDMEVLKELLPSSTLEHFEIRGYNSTSFPGWLIGISSYLPNLVEIKMVDLIMCENLPPLGQLPNLQELVLQKMPAIKKIDADLCGGARSFPSLRKFILSDMENLEEWSTTYSCGESFVNQFMFPNLQVLETRDCPKLRLKPCPPRAVKWDIWSSDNAILSWGERETRSSADSTISCPVSYLVVIFCKVPLHQWRLLHHLPSLPSLSINSCNDLTSSPEISQELSSLRYLTLHGNYEAELPKWLGELTSLQQLWISSKYPELKASQESIAQLTSLQSLYLTSCETIETLPQWLGVLTSLQDLGISHCPKLTNLHGTMRLRSLRSLHLSYCGSIVHLPEGLGNLTALTELSIWNCGGIKFLPESIRHLTNLFILDIAACPELKSWCASDENVMKLAHIERKVRILPNPSSY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
9-1366 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ASAVLKLAAQKMGSAIGGQILLHSNFHSDLREMKMTLESVEALLNDAERQSIDRESVRLWLQRLKHCSYDIADMLDEVEARTNPAAATVSLIPKIIMANKMKMMRTKLVKITNLHKDFGLTESVSCNVQQVTDPRASASKVEEAFIVGRTKEKQKVITILSEASTWQGTTILPIYGIGGIGKTTLAKLVFNDTGFKDYFQAWVYISQTFDLNKICNSIISQISGHENMMTEKQMINRRLEELLAGRKVLVVLDDLWEKGGSELDELKLMLKAGENSDIIVIVTTRDEGIAKKICTVQPYKLEPLTDNMCWKIIKQKSAFNDRDDKRQLEPIGRDIAKKCGGVALAAQSLGYILQSMTSDEWVSVRNSDIWSKSTSKGRSLPHHNVLASLLLSYSNMLPYLRLCFAYCAIFPKGYKIVQDDLIQQWIALDLIEPSDIFSVRQLSKNYISQLLGMSFLQHSKAPSVMLYKMLFLQTVGLHYEDVTLFTMHDLVHEVARSIMVDEVLYSRKEGNIAGTNCRYALLEDCSKPLELLTTTPNKIRALHFLDCAKIVPRGTAFSSATCLRVLDLSECYVHKLPDSIGQMKQLRYLKAPDIKDQTITKCITKLSKLSYLNLSRSQRVLVLPKSIGRMECLMHLDLSWCSQIGELPISFGKLKKLAHLNLSNCSEVSGVSESLGSLTQLQYLNLSYCRKIGELPQNLGKLVGLQYLNLSCSSYLDGLPTTEVLSTLTKLEYLNLSSELSYIGKLPEALGCFTELKYLNLSGCRGIDELPKSFGNLRNLVHLDFSKCYRVGRIAEALHGLTKLQYLNLSSCCYGNQLHLKGLPEVIRNLTELRYLNLSMCLDAIFDRKSAGENQTSVEFISNLANLEHLDLSKNISLSSLPESLGSLRKLHTLDLSGCSRLERVPESIATIDSLKFLIVMNCWKLDRFRLSRFNDNSILLPHFMVQAGDGESSSNLVQLQDANPAELEINNLENVKFAKDAQIIKLLQKQRILKLKLQWTTGSRRYAEDMEVLKELLPSSTLEHFEIRGYNSTSFPGWLIGISSYLPNLVEIKMVDLIMCENLPPLGQLPNLQELVLQKMPAIKKIDADLCGGARSFPSLRKFILSDMENLEEWSTTYSCGESFVNQFMFPNLQVLETRDCPKLRLKPCPPRAVKWDIWSSDNAILSWGERETRSSADSTISCPVSYLVVIFCKVPLHQWRLLHHLPSLPSLSINSCNDLTSSPEISQELSSLRYLTLHGNYEAELPKWLGELTSLQQLWISSKYPELKASQESIAQLTSLQSLYLTSCETIETLPQWLGVLTSLQDLGISHCPKLTNLHGTMRLRSLRSLHLSYCGSIVHLPEGLGNLTALTELSI

HMMPanther: PTHR23155:SF270
9-1366 PTHR23155:SF270,OS11G0211300 PROTEIN

ASAVLKLAAQKMGSAIGGQILLHSNFHSDLREMKMTLESVEALLNDAERQSIDRESVRLWLQRLKHCSYDIADMLDEVEARTNPAAATVSLIPKIIMANKMKMMRTKLVKITNLHKDFGLTESVSCNVQQVTDPRASASKVEEAFIVGRTKEKQKVITILSEASTWQGTTILPIYGIGGIGKTTLAKLVFNDTGFKDYFQAWVYISQTFDLNKICNSIISQISGHENMMTEKQMINRRLEELLAGRKVLVVLDDLWEKGGSELDELKLMLKAGENSDIIVIVTTRDEGIAKKICTVQPYKLEPLTDNMCWKIIKQKSAFNDRDDKRQLEPIGRDIAKKCGGVALAAQSLGYILQSMTSDEWVSVRNSDIWSKSTSKGRSLPHHNVLASLLLSYSNMLPYLRLCFAYCAIFPKGYKIVQDDLIQQWIALDLIEPSDIFSVRQLSKNYISQLLGMSFLQHSKAPSVMLYKMLFLQTVGLHYEDVTLFTMHDLVHEVARSIMVDEVLYSRKEGNIAGTNCRYALLEDCSKPLELLTTTPNKIRALHFLDCAKIVPRGTAFSSATCLRVLDLSECYVHKLPDSIGQMKQLRYLKAPDIKDQTITKCITKLSKLSYLNLSRSQRVLVLPKSIGRMECLMHLDLSWCSQIGELPISFGKLKKLAHLNLSNCSEVSGVSESLGSLTQLQYLNLSYCRKIGELPQNLGKLVGLQYLNLSCSSYLDGLPTTEVLSTLTKLEYLNLSSELSYIGKLPEALGCFTELKYLNLSGCRGIDELPKSFGNLRNLVHLDFSKCYRVGRIAEALHGLTKLQYLNLSSCCYGNQLHLKGLPEVIRNLTELRYLNLSMCLDAIFDRKSAGENQTSVEFISNLANLEHLDLSKNISLSSLPESLGSLRKLHTLDLSGCSRLERVPESIATIDSLKFLIVMNCWKLDRFRLSRFNDNSILLPHFMVQAGDGESSSNLVQLQDANPAELEINNLENVKFAKDAQIIKLLQKQRILKLKLQWTTGSRRYAEDMEVLKELLPSSTLEHFEIRGYNSTSFPGWLIGISSYLPNLVEIKMVDLIMCENLPPLGQLPNLQELVLQKMPAIKKIDADLCGGARSFPSLRKFILSDMENLEEWSTTYSCGESFVNQFMFPNLQVLETRDCPKLRLKPCPPRAVKWDIWSSDNAILSWGERETRSSADSTISCPVSYLVVIFCKVPLHQWRLLHHLPSLPSLSINSCNDLTSSPEISQELSSLRYLTLHGNYEAELPKWLGELTSLQQLWISSKYPELKASQESIAQLTSLQSLYLTSCETIETLPQWLGVLTSLQDLGISHCPKLTNLHGTMRLRSLRSLHLSYCGSIVHLPEGLGNLTALTELSI

superfamily: SSF52540
137-378 SSF52540

QQVTDPRASASKVEEAFIVGRTKEKQKVITILSEASTWQGTTILPIYGIGGIGKTTLAKLVFNDTGFKDYFQAWVYISQTFDLNKICNSIISQISGHENMMTEKQMINRRLEELLAGRKVLVVLDDLWEKGGSELDELKLMLKAGENSDIIVIVTTRDEGIAKKICTVQPYKLEPLTDNMCWKIIKQKSAFNDRDDKRQLEPIGRDIAKKCGGVALAAQSLGYILQSMTSDEWVSVRNSDIW

Gene3D: G3DSA:3.40.50.300
153-298 G3DSA:3.40.50.300

FIVGRTKEKQKVITILSEASTWQGTTILPIYGIGGIGKTTLAKLVFNDTGFKDYFQAWVYISQTFDLNKICNSIISQISGHENMMTEKQMINRRLEELLAGRKVLVVLDDLWEKGGSELDELKLMLKAGENSDIIVIVTTRDEGIA

HMMPfam: PF00931
IPR002182
158-443 NB-ARC,NBS
NB-ARC

TKEKQKVITILSEASTWQGTTILPIYGIGGIGKTTLAKLVFNDTGFKDYFQAWVYISQTFDLNKICNSIISQISGHENMMTEKQMINRRLEELLAGRKVLVVLDDLWEKGGSELDELKLMLKAGENSDIIVIVTTRDEGIAKKICTVQPYKLEPLTDNMCWKIIKQKSAFNDRDDKRQLEPIGRDIAKKCGGVALAAQSLGYILQSMTSDEWVSVRNSDIWSKSTSKGRSLPHHNVLASLLLSYSNMLPYLRLCFAYCAIFPKGYKIVQDDLIQQWIALDLIEPSD

FPrintScan: PR00364
IPR000767
179-194 DISEASERSIST
Disease resistance protein

ILPIYGIGGIGKTTLA

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

LLAGRKVLVVLDDLW

FPrintScan: PR00364
IPR000767
347-361 DISEASERSIST
Disease resistance protein

CGGVALAAQSLGYIL

superfamily: SSF52058
519-831 SSF52058,LRR

NIAGTNCRYALLEDCSKPLELLTTTPNKIRALHFLDCAKIVPRGTAFSSATCLRVLDLSECYVHKLPDSIGQMKQLRYLKAPDIKDQTITKCITKLSKLSYLNLSRSQRVLVLPKSIGRMECLMHLDLSWCSQIGELPISFGKLKKLAHLNLSNCSEVSGVSESLGSLTQLQYLNLSYCRKIGELPQNLGKLVGLQYLNLSCSSYLDGLPTTEVLSTLTKLEYLNLSSELSYIGKLPEALGCFTELKYLNLSGCRGIDELPKSFGNLRNLVHLDFSKCYRVGRIAEALHGLTKLQYLNLSSCCYGNQLHLKGL

Gene3D: G3DSA:3.80.10.10
545-717 G3DSA:3.80.10.10

NKIRALHFLDCAKIVPRGTAFSSATCLRVLDLSECYVHKLPDSIGQMKQLRYLKAPDIKDQTITKCITKLSKLSYLNLSRSQRVLVLPKSIGRMECLMHLDLSWCSQIGELPISFGKLKKLAHLNLSNCSEVSGVSESLGSLTQLQYLNLSYCRKIGELPQNLGKLVGLQYLN

HMMPfam: PF13504
569-585 LRR_7,Leucine rich repeat

TCLRVLDLSECYVHKLP

HMMPfam: PF13855
641-698 LRR_8,Leucine rich repeat

LMHLDLSWCSQIGELPISFGKLKKLAHLNLSNCSEVSGVSESLGSLTQLQYLNLSYCR

Gene3D: G3DSA:3.80.10.10
718-932 G3DSA:3.80.10.10

LSCSSYLDGLPTTEVLSTLTKLEYLNLSSELSYIGKLPEALGCFTELKYLNLSGCRGIDELPKSFGNLRNLVHLDFSKCYRVGRIAEALHGLTKLQYLNLSSCCYGNQLHLKGLPEVIRNLTELRYLNLSMCLDAIFDRKSAGENQTSVEFISNLANLEHLDLSKNISLSSLPESLGSLRKLHTLDLSGCSRLERVPESIATIDSLKFLIVMNCW

superfamily: SSF52047
736-1117 SSF52047,LRR

LTKLEYLNLSSELSYIGKLPEALGCFTELKYLNLSGCRGIDELPKSFGNLRNLVHLDFSKCYRVGRIAEALHGLTKLQYLNLSSCCYGNQLHLKGLPEVIRNLTELRYLNLSMCLDAIFDRKSAGENQTSVEFISNLANLEHLDLSKNISLSSLPESLGSLRKLHTLDLSGCSRLERVPESIATIDSLKFLIVMNCWKLDRFRLSRFNDNSILLPHFMVQAGDGESSSNLVQLQDANPAELEINNLENVKFAKDAQIIKLLQKQRILKLKLQWTTGSRRYAEDMEVLKELLPSSTLEHFEIRGYNSTSFPGWLIGISSYLPNLVEIKMVDLIMCENLPPLGQLPNLQELVLQKMPAIKKIDADLCGGARSFPSLRKFILSDM

HMMPfam: PF13855
763-820 LRR_8,Leucine rich repeat

ELKYLNLSGCRGIDELPKSFGNLRNLVHLDFSKCYRVGRIAEALHGLTKLQYLNLSSC

HMMPfam: PF12799
874-907 LRR_4,Leucine Rich repeats (2 copies)

NLEHLDLSKNISLSSLPESLGSLRKLHTLDLSGC

FPrintScan: PR00364
IPR000767
894-910 DISEASERSIST
Disease resistance protein

GSLRKLHTLDLSGCSRL

Gene3D: G3DSA:3.80.10.10
982-1150 G3DSA:3.80.10.10

ENVKFAKDAQIIKLLQKQRILKLKLQWTTGSRRYAEDMEVLKELLPSSTLEHFEIRGYNSTSFPGWLIGISSYLPNLVEIKMVDLIMCENLPPLGQLPNLQELVLQKMPAIKKIDADLCGGARSFPSLRKFILSDMENLEEWSTTYSCGESFVNQFMFPNLQVLETRDC

superfamily: SSF52058
1185-1399 SSF52058,LRR

SADSTISCPVSYLVVIFCKVPLHQWRLLHHLPSLPSLSINSCNDLTSSPEISQELSSLRYLTLHGNYEAELPKWLGELTSLQQLWISSKYPELKASQESIAQLTSLQSLYLTSCETIETLPQWLGVLTSLQDLGISHCPKLTNLHGTMRLRSLRSLHLSYCGSIVHLPEGLGNLTALTELSIWNCGGIKFLPESIRHLTNLFILDIAACPELKSW

Gene3D: G3DSA:3.80.10.10
1209-1409 G3DSA:3.80.10.10

WRLLHHLPSLPSLSINSCNDLTSSPEISQELSSLRYLTLHGNYEAELPKWLGELTSLQQLWISSKYPELKASQESIAQLTSLQSLYLTSCETIETLPQWLGVLTSLQDLGISHCPKLTNLHGTMRLRSLRSLHLSYCGSIVHLPEGLGNLTALTELSIWNCGGIKFLPESIRHLTNLFILDIAACPELKSWCASDENVMKL

HMMPfam: PF00560
IPR001611
1336-1358 LRR_1
Leucine-rich repeat

SLRSLHLSYCGSIVHLPEGLGNL


List of References

Jetty S S Ammiraju, Fei Lu, Abhijit Sanyal, Yeisoo Yu, Xiang Song, Ning Jiang, Ana Clara Pontaroli, Teri Rambo, Jennifer Currie, Kristi Collura, Jayson Talag, Chuanzhu Fan, Jose Luis Goicoechea, Andrea Zuccolo, Jinfeng Chen, Jeffrey L Bennetzen, Mingsheng Chen, Scott Jackson, Rod A Wing
Dynamic evolution of oryza genomes is revealed by comparative genomic analysis of a genus-wide vertical data set.
Plant Cell: 2008, 20(12);3191-209
PubMed:19098269 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox