PRGDB00062126 (leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223452537 (FJ014843)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

Glycine max clone cw164 leucine-rich repeat disease resistance protein mRNA, complete cds.

DNA Sequence

ATGCAAAATCTCAATTTCCTCTACCTAACCATCATTTCCCTCACTCTCATCCACTTCCACTGCATCCTAGTCCAAGCACAAACCTCACCCTCAGACATTGCAGCACTCAAAGCCTTCAAGGCCTCAATCAAACCCTCCTCCATCACTCCCTGGTCATGCCTCGCCTCATGGAACTTCACAACCGACCCATGCTCACTCCCTCGCCGAACCTCCTTCATCTGCGGCCTCACCTGCACCCAAGACTCCACAAGAATCAACCAAATCACTCTCGACCCAGCAGGGTACTCAGGCACACTCACCCCACTAATCTCTCAACTCACACAACTCACCACACTTGACCTCGCTGATAACAACTTCTTTGGCCCAATCCCCTCTTCAATCTCTTTACTCTCAAACCTCCAAACCTTAACCCTTCGATCCAATTCCTTCTCGGGCACAATCCCTCCCTCCATAACCACCCTCAAATCACTCCTATCTCTCGACCTCGCACACAATTCCCTCTCTGGGTATCTCCCAAACTCAATGAACTCCCTCACCACACTCCGCAGACTCGATCTCAGCTTCAACAAACTAACCGGTTCAATCCCAAAGCTCCCATCCAACTTGCTCGAACTCGCGATCAAGGCCAATTCTCTATCTGGGCCTCTCCAAAAACAGAGCTTTGAAGGGATGAACCAGTTGGAAGTGGTGGAGCTCAGCGAGAACGCGCTCACCGGAACCGTGGAGTCGTGGTTCTTCCTTTTGCCGTCGCTGCAGCAAGTGGACTTGGCCAACAACACCTTCACGGGGGTGCAGATCTCGAGGCCACTCGCGGCCCGTGGAGGAAGCAGCAGCAGCAGTGGCAACAGCAACCTCGTCGCGCTGAACCTCGGGTTTAACAGAATCCGAGGCTACGCGCCCGCGAATCTCGGCGCGTATCCCGCGCTGTCTTTCCTGTCGATTCGGTACAACGCGCTGCGTGGCGCGATCCCGCTGGAGTACGGGCAGATCAAGTCCATGAAGAGGCTGTTCCTCGACGGGAACTTTTTCGTCGGAAAGCCGCCGGCGGGGCTGGTGGCGGCCGGAACAGCGGTTTCCGGCAGCCTGGGGGACAATTGCCTGCAGGCGTGCCCAGGGTCGTCGCAGCTGTGCTCCCCCGCGCAGAAACCTAGCTCTGTTTGCAAGCAAGCCTACCGTGGTAGACCAACACCGTAA


Protein sequences

Name Description Sequence
leucine-rich repeat disease resistance protein leucine-rich repeat disease resistance protein [Glycine max].

MQNLNFLYLTIISLTLIHFHCILVQAQTSPSDIAALKAFKASIKPSSITPWSCLASWNFTTDPCSLPRRTSFICGLTCTQDSTRINQITLDPAGYSGTLTPLISQLTQLTTLDLADNNFFGPIPSSISLLSNLQTLTLRSNSFSGTIPPSITTLKSLLSLDLAHNSLSGYLPNSMNSLTTLRRLDLSFNKLTGSIPKLPSNLLELAIKANSLSGPLQKQSFEGMNQLEVVELSENALTGTVESWFFLLPSLQQVDLANNTFTGVQISRPLAARGGSSSSSGNSNLVALNLGFNRIRGYAPANLGAYPALSFLSIRYNALRGAIPLEYGQIKSMKRLFLDGNFFVGKPPAGLVAAGTAVSGSLGDNCLQACPGSSQLCSPAQKPSSVCKQAYRGRPTP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-368 PTHR24420:SF473,SUBFAMILY NOT NAMED

MQNLNFLYLTIISLTLIHFHCILVQAQTSPSDIAALKAFKASIKPSSITPWSCLASWNFTTDPCSLPRRTSFICGLTCTQDSTRINQITLDPAGYSGTLTPLISQLTQLTTLDLADNNFFGPIPSSISLLSNLQTLTLRSNSFSGTIPPSITTLKSLLSLDLAHNSLSGYLPNSMNSLTTLRRLDLSFNKLTGSIPKLPSNLLELAIKANSLSGPLQKQSFEGMNQLEVVELSENALTGTVESWFFLLPSLQQVDLANNTFTGVQISRPLAARGGSSSSSGNSNLVALNLGFNRIRGYAPANLGAYPALSFLSIRYNALRGAIPLEYGQIKSMKRLFLDGNFFVGKPPAGLVAAGTAVSGSLGDNCLQ

HMMPanther: PTHR24420
1-368 PTHR24420,FAMILY NOT NAMED

MQNLNFLYLTIISLTLIHFHCILVQAQTSPSDIAALKAFKASIKPSSITPWSCLASWNFTTDPCSLPRRTSFICGLTCTQDSTRINQITLDPAGYSGTLTPLISQLTQLTTLDLADNNFFGPIPSSISLLSNLQTLTLRSNSFSGTIPPSITTLKSLLSLDLAHNSLSGYLPNSMNSLTTLRRLDLSFNKLTGSIPKLPSNLLELAIKANSLSGPLQKQSFEGMNQLEVVELSENALTGTVESWFFLLPSLQQVDLANNTFTGVQISRPLAARGGSSSSSGNSNLVALNLGFNRIRGYAPANLGAYPALSFLSIRYNALRGAIPLEYGQIKSMKRLFLDGNFFVGKPPAGLVAAGTAVSGSLGDNCLQ

superfamily: SSF52058
26-353 SSF52058,LRR

AQTSPSDIAALKAFKASIKPSSITPWSCLASWNFTTDPCSLPRRTSFICGLTCTQDSTRINQITLDPAGYSGTLTPLISQLTQLTTLDLADNNFFGPIPSSISLLSNLQTLTLRSNSFSGTIPPSITTLKSLLSLDLAHNSLSGYLPNSMNSLTTLRRLDLSFNKLTGSIPKLPSNLLELAIKANSLSGPLQKQSFEGMNQLEVVELSENALTGTVESWFFLLPSLQQVDLANNTFTGVQISRPLAARGGSSSSSGNSNLVALNLGFNRIRGYAPANLGAYPALSFLSIRYNALRGAIPLEYGQIKSMKRLFLDGNFFVGKPPAGLVA

HMMPfam: PF08263
IPR013210
30-65 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PSDIAALKAFKASIKPSSITPWSCLASWNFTTDPCS

Gene3D: G3DSA:3.80.10.10
32-264 G3DSA:3.80.10.10

DIAALKAFKASIKPSSITPWSCLASWNFTTDPCSLPRRTSFICGLTCTQDSTRINQITLDPAGYSGTLTPLISQLTQLTTLDLADNNFFGPIPSSISLLSNLQTLTLRSNSFSGTIPPSITTLKSLLSLDLAHNSLSGYLPNSMNSLTTLRRLDLSFNKLTGSIPKLPSNLLELAIKANSLSGPLQKQSFEGMNQLEVVELSENALTGTVESWFFLLPSLQQVDLANNTFTGV

HMMPfam: PF13516
106-128 LRR_6,Leucine Rich repeat

LTQLTTLDLADNNFFGPIPSSIS

ProfileScan: PS51450
IPR001611
108-130 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLTTLDLADNNFFGPIPSSISLL

HMMPfam: PF13855
131-191 LRR_8,Leucine rich repeat

SNLQTLTLRSNSFSGTIPPSITTLKSLLSLDLAHNSLSGYLPNSMNSLTTLRRLDLSFNKL

ProfileScan: PS51450
IPR001611
132-154 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLTLRSNSFSGTIPPSITTL

ProfileScan: PS51450
IPR001611
156-178 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLSLDLAHNSLSGYLPNSMNSL

FPrintScan: PR00019
157-170 LEURICHRPT,Leucine-rich repeat signature

LLSLDLAHNSLSGY

FPrintScan: PR00019
178-191 LEURICHRPT,Leucine-rich repeat signature

LTTLRRLDLSFNKL

ProfileScan: PS51450
IPR001611
180-202 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRRLDLSFNKLTGSIPKLPSNL

HMMPfam: PF13855
201-259 LRR_8,Leucine rich repeat

NLLELAIKANSLSGPLQKQSFEGMNQLEVVELSENALTGTVESWFFLLPSLQQVDLANN

ProfileScan: PS51450
IPR001611
226-248 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEVVELSENALTGTVESWFFLL

ProfileScan: PS51450
IPR001611
250-271 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQQVDLANNTFTGVQISRPLA

Gene3D: G3DSA:3.80.10.10
280-350 G3DSA:3.80.10.10

SGNSNLVALNLGFNRIRGYAPANLGAYPALSFLSIRYNALRGAIPLEYGQIKSMKRLFLDGNFFVGKPPAG

ProfileScan: PS51450
IPR001611
284-304 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVALNLGFNRIRGYAPANLG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox