PRGDB00062145 (disease resistance protein (TIR-NBS-LRR class))

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class)
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223403522 (FJ613384)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Estland disease resistance protein (TIR-NBS-LRR class) (At5g44870) mRNA, complete cds.

DNA Sequence

ATGGCAGCATCTTCCGAAATACTCCCGGAGTCGTGGCAAGTGTTCATCAATTTCCGAGGAGCAGATTTGCGCAACGGTTTCATCAGCCATCTGGCGGGAGCTTTGACCTCAGCTGGAATCACATACTACATCGACACGGAAGAAGTCCCGAGCGAAGATCTCACTGTCCTTTTCAAGAGGATAGAGGAATCGGAAATCGCACTGTCCATCTTCTCGAGCAATTATGCTGAGTCAAAATGGTGTTTGGACGAGCTCGTGAAGATCATGGAACAAGTAAAGAAAGGAAAGCTCAGAATCATGCCCGTCTTCTTCAACGTGAAGCCAGAGGAGGTGAGAGAGCAGAACGGAGAGTTCGGACTTAAGCTTTACGGAGAAGGTAAAAGCAAACGACCCAACATACCTAATTGGGAGAACGCTTTGCGGTCTGTCCCAAGCAAGATAGGCTTGAATTTGGCGAATTTTAGAAACGAGAAGGAACTCCTTGACAAGATCATTGACTCCATCAAAAAAGTACTTGCCCGAATTACACGAGCAAGCAGAGTAGCAGAATCTCTAAACGGGATCTCAAAAGACTCAGAGGCAAAGAATGTAGACACATTTTCGCCAAACTCCAGTGATTTTCCATCTACTTCCATTGACGACGACCTCAGTATCAACTCGCCTCAGTACCAAGCCACAATTCCCCCCGCAAGCAGGGAAGGTGAACGTCTCAACACGATCTCTACTGTAAGTTCAACTGGTAGTATTGAACATCCTCCACCCAACTACGGAATAGAACCACGCCTTAAGGAGATGGAAGAAAAGTTAGATTTTGATAGCCTCGAAACTAAAACTGTTGGAATTGTTGGGATGCCTGGGATTGGTAAAACCACTCTTGCAGAAACGTTGTATAGAAAGTGGGAACACAAGTTTGAGAGGAGTATGTTTTTCCCAGATGCCAGTAAGATGGCGAATGAACACGGAATGTGTTGGCTGCAGAAGAGATTATTGGAAGAGCTGTTGAAGGATACTAATCTCAACATAGGATATACAACGAATGAACATGAGTTTTGTAAGGATGTTCTTCTCCTAAAGAAAGTTTTTCTTGTCATAGATAATGTTAGTAGCGAGGAACAGATCGAAACTCTTTTTGGTAAATGGAATTGGATTAAAAATGGAAGCAAGATTGTTATTACGTCAAGTGATGAGTCAATGCTCAAGGGTTTCGTTAAAGATACTTATGTAGTCCCAAGTTTGAACAGCAGAGACAGTCTACTGTGGTTTACTAATCATGCATTTGGTTTGGATGATGCCCAGGGAAACTTGGTAAAGTTGTCCAAACACTTTCTGAATTATGCCAAAGGCAACCCACTAGCCCTCGGAGCTTTTGGTGTAGAACTTTGTGGGAAAGACAAGGCTGATTGGGAAAAGAGAATAAAAACATTGACACTAATTTCCAATAAGATGATCCAAGATGTCTTGAGAAGAAGGTATGATGAACTCACAGAGAGGCAGAAAGATATTTTTCTTGACGTCGCATGTTTCTTCAAATCAGAGAATGAAAGTTATGTACGACACGTGGTGAATTCATGTGATTCTGAGTCTACTAAGAGTTGGGATGAAATAACAGACCTCAAAGGAAAGTTTCTTGTCAATATTTCTGGTGGTCGAGTTGAGATGCATGATATACTATGCACATTCGCCAAGGAACTTGCTTCACAAGCATTGACTGAAGATACAAGGGTTCATCTCAGGCTGTGGAACTATCAAGATATCATGTGGTTTCTCAACAATGAATTGGAAATGGAAAATGTCAGAGGTATTTTCTTAGACATGTCTAAAGTTCCGGAGGAAATGACATTTGATGGTAACATCTTTAGCAATATGTGCAATCTTCGATATCTCAAAATATACAGTTCTGTTTGCCATAAGGAAGGCGAAGGTATCTTCAAATTTGACACAGTTAGGGAAATTCAGTTACCATTAGACAAGGTACGCTATCTCCACTGGATGAAATATCCATGGGAGAAACTTCCATCAGACTTCAACCCGGAGAATCTCGTTGATCTTGAACTGCCTTATAGCTCCATTAAGAAAGTTTGGGAGGGTGTTAAGGATACCCCGATACTAAAGTGGGCCAATCTAAGCTATTCAAGTAAGTTGACTAACCTTTTAGGGTTGTCAAATGCTAAAAATCTTGAAAGATTGAATCTTGAAGGTTGCACAAGTTTGCTTAAACTGCCCCAAGAGATGGAGAACATGAAAAGTCTTGTCTTCCTGAACATGAGACGTTGCACTAGTCTCACATGTCTTCAAAGTATTAAAGTGAGCTCTCTGAAAATTCTCATACTCAGCGACTGCTCAAAACTTGAGGAATTTGAAGTGATTTCGGAAAATCTGGAAGAATTATATTTAGATGGAACTGCAATAAAGGGACTTCCTCCAGCGGCCGGGGATCTGACGAGACTTGTCGTCTTAAATATGGAAGGCTGTACAGAACTGGAGAGTCTTCCCAAACGTCTTGGAAAACAGAAAGCTCTTCAAGAACTGGTACTCTCTGGATGTTCAAAGCTCGAGAGTGTTCCAACGGTCGTACAAGACATGAAACATCTACGGATCTTATTGCTTGACGGCACAAGAATCAGAAAGATCCCGAAGATAAAGTCGCTAAAGTGTTTGTGCTTAAGTAGAAATATTGCAATGGTCAATCTACAAGATAATCTCAAAGATTTCTATTATCTGAAATGTCTTGTCATGAAGAACTGCGAGAATCTCAGATATCTTCCTTCGCTTCCAAAATGTCTTGAGTACCTAAACGTATATGGTTGTGAAAGACTAGAATCAGTTGAGAATCCACTGGTTTCTGATAGGTTATTCCTTGATGGATTGGAGAAATTACGTTCCACTTTCTTGTTCACTAATTGCCACAATCTGTTTCAAGATGCAAAGGACTCAATCTCAACCTACGCGAAATGGAAATGCCACCGACTTGCAGTTGAATGCTACGAACAGGACAAAGTTTCTGGAGCTTTTTTCAACACTTGCTATCCTGGATATATAGTCCCTTCGTGGTTCGACCACCAAGCAGTTGGATCAGTCTTAGAGCCAAGGCTGGAACCACATTGGTATAACACTATGCTTTCTGGGATAGCTCTATGTGCAGTTGTATCATTCCATGAGAACCAAGATCCGATCATCGGCAGTTTCTCAGTAAAATGCACATTGCAATTTGAAAACGAAGATGGGTCTCTTCGCTTTGATTGTGATATCGGATGTTTCAACGAACCAGGAATGATTGAGGCAGACCATGTTTTTATCGGCTATGTCACTTGCTCACGTTTGAAAGATCACCACTCTATACCTATTCATCACCCTACAACTGTAAAAATGAAGTTCCACTTGACTGATGCTTGTAAAAGTAAAGTGGTGGATTGTGGGTTCCGTTTGATGTACACCCAGAGCCGTGGCTGTTTGTTAAGGGAAGAAGTCGCCGCCAACTTCACTAAATTATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class) disease resistance protein (TIR-NBS-LRR class) [Arabidopsis thaliana].

MAASSEILPESWQVFINFRGADLRNGFISHLAGALTSAGITYYIDTEEVPSEDLTVLFKRIEESEIALSIFSSNYAESKWCLDELVKIMEQVKKGKLRIMPVFFNVKPEEVREQNGEFGLKLYGEGKSKRPNIPNWENALRSVPSKIGLNLANFRNEKELLDKIIDSIKKVLARITRASRVAESLNGISKDSEAKNVDTFSPNSSDFPSTSIDDDLSINSPQYQATIPPASREGERLNTISTVSSTGSIEHPPPNYGIEPRLKEMEEKLDFDSLETKTVGIVGMPGIGKTTLAETLYRKWEHKFERSMFFPDASKMANEHGMCWLQKRLLEELLKDTNLNIGYTTNEHEFCKDVLLLKKVFLVIDNVSSEEQIETLFGKWNWIKNGSKIVITSSDESMLKGFVKDTYVVPSLNSRDSLLWFTNHAFGLDDAQGNLVKLSKHFLNYAKGNPLALGAFGVELCGKDKADWEKRIKTLTLISNKMIQDVLRRRYDELTERQKDIFLDVACFFKSENESYVRHVVNSCDSESTKSWDEITDLKGKFLVNISGGRVEMHDILCTFAKELASQALTEDTRVHLRLWNYQDIMWFLNNELEMENVRGIFLDMSKVPEEMTFDGNIFSNMCNLRYLKIYSSVCHKEGEGIFKFDTVREIQLPLDKVRYLHWMKYPWEKLPSDFNPENLVDLELPYSSIKKVWEGVKDTPILKWANLSYSSKLTNLLGLSNAKNLERLNLEGCTSLLKLPQEMENMKSLVFLNMRRCTSLTCLQSIKVSSLKILILSDCSKLEEFEVISENLEELYLDGTAIKGLPPAAGDLTRLVVLNMEGCTELESLPKRLGKQKALQELVLSGCSKLESVPTVVQDMKHLRILLLDGTRIRKIPKIKSLKCLCLSRNIAMVNLQDNLKDFYYLKCLVMKNCENLRYLPSLPKCLEYLNVYGCERLESVENPLVSDRLFLDGLEKLRSTFLFTNCHNLFQDAKDSISTYAKWKCHRLAVECYEQDKVSGAFFNTCYPGYIVPSWFDHQAVGSVLEPRLEPHWYNTMLSGIALCAVVSFHENQDPIIGSFSVKCTLQFENEDGSLRFDCDIGCFNEPGMIEADHVFIGYVTCSRLKDHHSIPIHHPTTVKMKFHLTDACKSKVVDCGFRLMYTQSRGCLLREEVAANFTKL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-149 TIR
Toll-Interleukin receptor

MAASSEILPESWQVFINFRGADLRNGFISHLAGALTSAGITYYIDTEEVPSEDLTVLFKRIEESEIALSIFSSNYAESKWCLDELVKIMEQVKKGKLRIMPVFFNVKPEEVREQNGEFGLKLYGEGKSKRPNIPNWENALRSVPSKIGL

ProfileScan: PS50104
IPR000157
10-146 TIR
Toll-Interleukin receptor

ESWQVFINFRGADLRNGFISHLAGALTSAGITYYIDTEEVPSEDLTVLFKRIEESEIALSIFSSNYAESKWCLDELVKIMEQVKKGKLRIMPVFFNVKPEEVREQNGEFGLKLYGEGKSKRPNIPNWENALRSVPSK

Gene3D: G3DSA:3.40.50.10140
11-131 G3DSA:3.40.50.10140

SWQVFINFRGADLRNGFISHLAGALTSAGITYYIDTEEVPSEDLTVLFKRIEESEIALSIFSSNYAESKWCLDELVKIMEQVKKGKLRIMPVFFNVKPEEVREQNGEFGLKLYGEGKSKRP

HMMSmart: SM00255
IPR000157
11-146 TIR
Toll-Interleukin receptor

SWQVFINFRGADLRNGFISHLAGALTSAGITYYIDTEEVPSEDLTVLFKRIEESEIALSIFSSNYAESKWCLDELVKIMEQVKKGKLRIMPVFFNVKPEEVREQNGEFGLKLYGEGKSKRPNIPNWENALRSVPSK

HMMPfam: PF01582
IPR000157
14-141 TIR
Toll-Interleukin receptor

VFINFRGADLRNGFISHLAGALTSAGITYYIDTEEVPSEDLTVLFKRIEESEIALSIFSSNYAESKWCLDELVKIMEQVKKGKLRIMPVFFNVKPEEVREQNGEFGLKLYGEGKSKRPNIPNWENALR

HMMPanther: PTHR23155
21-980 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ADLRNGFISHLAGALTSAGITYYIDTEEVPSEDLTVLFKRIEESEIALSIFSSNYAESKWCLDELVKIMEQVKKGKLRIMPVFFNVKPEEVREQNGEFGLKLYGEGKSKRPNIPNWENALRSVPSKIGLNLANFRNEKELLDKIIDSIKKVLARITRASRVAESLNGISKDSEAKNVDTFSPNSSDFPSTSIDDDLSINSPQYQATIPPASREGERLNTISTVSSTGSIEHPPPNYGIEPRLKEMEEKLDFDSLETKTVGIVGMPGIGKTTLAETLYRKWEHKFERSMFFPDASKMANEHGMCWLQKRLLEELLKDTNLNIGYTTNEHEFCKDVLLLKKVFLVIDNVSSEEQIETLFGKWNWIKNGSKIVITSSDESMLKGFVKDTYVVPSLNSRDSLLWFTNHAFGLDDAQGNLVKLSKHFLNYAKGNPLALGAFGVELCGKDKADWEKRIKTLTLISNKMIQDVLRRRYDELTERQKDIFLDVACFFKSENESYVRHVVNSCDSESTKSWDEITDLKGKFLVNISGGRVEMHDILCTFAKELASQALTEDTRVHLRLWNYQDIMWFLNNELEMENVRGIFLDMSKVPEEMTFDGNIFSNMCNLRYLKIYSSVCHKEGEGIFKFDTVREIQLPLDKVRYLHWMKYPWEKLPSDFNPENLVDLELPYSSIKKVWEGVKDTPILKWANLSYSSKLTNLLGLSNAKNLERLNLEGCTSLLKLPQEMENMKSLVFLNMRRCTSLTCLQSIKVSSLKILILSDCSKLEEFEVISENLEELYLDGTAIKGLPPAAGDLTRLVVLNMEGCTELESLPKRLGKQKALQELVLSGCSKLESVPTVVQDMKHLRILLLDGTRIRKIPKIKSLKCLCLSRNIAMVNLQDNLKDFYYLKCLVMKNCENLRYLPSLPKCLEYLNVYGCERLESVENPLVSDRLFLDGLEKLRSTFLFTNCHNLFQDAKDSIS

HMMPanther: PTHR23155:SF68
21-980 PTHR23155:SF68,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

ADLRNGFISHLAGALTSAGITYYIDTEEVPSEDLTVLFKRIEESEIALSIFSSNYAESKWCLDELVKIMEQVKKGKLRIMPVFFNVKPEEVREQNGEFGLKLYGEGKSKRPNIPNWENALRSVPSKIGLNLANFRNEKELLDKIIDSIKKVLARITRASRVAESLNGISKDSEAKNVDTFSPNSSDFPSTSIDDDLSINSPQYQATIPPASREGERLNTISTVSSTGSIEHPPPNYGIEPRLKEMEEKLDFDSLETKTVGIVGMPGIGKTTLAETLYRKWEHKFERSMFFPDASKMANEHGMCWLQKRLLEELLKDTNLNIGYTTNEHEFCKDVLLLKKVFLVIDNVSSEEQIETLFGKWNWIKNGSKIVITSSDESMLKGFVKDTYVVPSLNSRDSLLWFTNHAFGLDDAQGNLVKLSKHFLNYAKGNPLALGAFGVELCGKDKADWEKRIKTLTLISNKMIQDVLRRRYDELTERQKDIFLDVACFFKSENESYVRHVVNSCDSESTKSWDEITDLKGKFLVNISGGRVEMHDILCTFAKELASQALTEDTRVHLRLWNYQDIMWFLNNELEMENVRGIFLDMSKVPEEMTFDGNIFSNMCNLRYLKIYSSVCHKEGEGIFKFDTVREIQLPLDKVRYLHWMKYPWEKLPSDFNPENLVDLELPYSSIKKVWEGVKDTPILKWANLSYSSKLTNLLGLSNAKNLERLNLEGCTSLLKLPQEMENMKSLVFLNMRRCTSLTCLQSIKVSSLKILILSDCSKLEEFEVISENLEELYLDGTAIKGLPPAAGDLTRLVVLNMEGCTELESLPKRLGKQKALQELVLSGCSKLESVPTVVQDMKHLRILLLDGTRIRKIPKIKSLKCLCLSRNIAMVNLQDNLKDFYYLKCLVMKNCENLRYLPSLPKCLEYLNVYGCERLESVENPLVSDRLFLDGLEKLRSTFLFTNCHNLFQDAKDSIS

superfamily: SSF52540
238-494 SSF52540

NTISTVSSTGSIEHPPPNYGIEPRLKEMEEKLDFDSLETKTVGIVGMPGIGKTTLAETLYRKWEHKFERSMFFPDASKMANEHGMCWLQKRLLEELLKDTNLNIGYTTNEHEFCKDVLLLKKVFLVIDNVSSEEQIETLFGKWNWIKNGSKIVITSSDESMLKGFVKDTYVVPSLNSRDSLLWFTNHAFGLDDAQGNLVKLSKHFLNYAKGNPLALGAFGVELCGKDKADWEKRIKTLTLISNKMIQDVLRRRYDEL

Gene3D: G3DSA:3.40.50.300
256-404 G3DSA:3.40.50.300

YGIEPRLKEMEEKLDFDSLETKTVGIVGMPGIGKTTLAETLYRKWEHKFERSMFFPDASKMANEHGMCWLQKRLLEELLKDTNLNIGYTTNEHEFCKDVLLLKKVFLVIDNVSSEEQIETLFGKWNWIKNGSKIVITSSDESMLKGFVK

HMMPfam: PF00931
IPR002182
261-513 NB-ARC,NBS
NB-ARC

RLKEMEEKLDFDSLETKTVGIVGMPGIGKTTLAETLYRKWEHKFERSMFFPDASKMANEHGMCWLQKRLLEELLKDTNLNIGYTTNEHEFCKDVLLLKKVFLVIDNVSSEEQIETLFGKWNWIKNGSKIVITSSDESMLKGFVKDTYVVPSLNSRDSLLWFTNHAFGLDDAQGNLVKLSKHFLNYAKGNPLALGAFGVELCGKDKADWEKRIKTLTLISNKMIQDVLRRRYDELTERQKDIFLDVACFFKSEN

FPrintScan: PR00364
IPR000767
278-293 DISEASERSIST
Disease resistance protein

TVGIVGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
354-368 DISEASERSIST
Disease resistance protein

VLLLKKVFLVIDNVS

FPrintScan: PR00364
IPR000767
446-460 DISEASERSIST
Disease resistance protein

AKGNPLALGAFGVEL

superfamily: SSF46785
481-590 SSF46785

KMIQDVLRRRYDELTERQKDIFLDVACFFKSENESYVRHVVNSCDSESTKSWDEITDLKGKFLVNISGGRVEMHDILCTFAKELASQALTEDTRVHLRLWNYQDIMWFLN

superfamily: SSF52058
552-967 SSF52058,LRR

EMHDILCTFAKELASQALTEDTRVHLRLWNYQDIMWFLNNELEMENVRGIFLDMSKVPEEMTFDGNIFSNMCNLRYLKIYSSVCHKEGEGIFKFDTVREIQLPLDKVRYLHWMKYPWEKLPSDFNPENLVDLELPYSSIKKVWEGVKDTPILKWANLSYSSKLTNLLGLSNAKNLERLNLEGCTSLLKLPQEMENMKSLVFLNMRRCTSLTCLQSIKVSSLKILILSDCSKLEEFEVISENLEELYLDGTAIKGLPPAAGDLTRLVVLNMEGCTELESLPKRLGKQKALQELVLSGCSKLESVPTVVQDMKHLRILLLDGTRIRKIPKIKSLKCLCLSRNIAMVNLQDNLKDFYYLKCLVMKNCENLRYLPSLPKCLEYLNVYGCERLESVENPLVSDRLFLDGLEKLRSTFLFTN

Gene3D: G3DSA:3.80.10.10
617-772 G3DSA:3.80.10.10

NIFSNMCNLRYLKIYSSVCHKEGEGIFKFDTVREIQLPLDKVRYLHWMKYPWEKLPSDFNPENLVDLELPYSSIKKVWEGVKDTPILKWANLSYSSKLTNLLGLSNAKNLERLNLEGCTSLLKLPQEMENMKSLVFLNMRRCTSLTCLQSIKVSSL

HMMPfam: PF07725
IPR011713
679-698 LRR_3
Leucine-rich repeat 3

NLVDLELPYSSIKKVWEGVK

FPrintScan: PR00364
IPR000767
767-783 DISEASERSIST
Disease resistance protein

IKVSSLKILILSDCSKL

Gene3D: G3DSA:3.80.10.10
773-959 G3DSA:3.80.10.10

KILILSDCSKLEEFEVISENLEELYLDGTAIKGLPPAAGDLTRLVVLNMEGCTELESLPKRLGKQKALQELVLSGCSKLESVPTVVQDMKHLRILLLDGTRIRKIPKIKSLKCLCLSRNIAMVNLQDNLKDFYYLKCLVMKNCENLRYLPSLPKCLEYLNVYGCERLESVENPLVSDRLFLDGLEKL

ProfileScan: PS51450
IPR001611
792-813 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELYLDGTAIKGLPPAAGDL

ProfileScan: PS51450
IPR001611
863-884 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRILLLDGTRIRKIPKIKSLK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox