PRGDB00062146 (RPS2-like disease resistance protein)

From PRG Wiki
Jump to: navigation, search
RPS2-like disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22218105 (AF315087)
Gene Class NL
Domain Type NBS, LRR
Gene Species Brassica rapa subsp. oleifera

Comment?

Brassica rapa subsp. oleifera RPS2-like disease resistance protein gene, partial cds.

DNA Sequence

TTAATGCAGAGCATTAACAACGAGCTGATCACAAAAGGTCATCAGTACRATGTACTGATATGGGTTACAATGTCCCGTGAATTCGGAGAGTGTACAATTCAGCAAGCTGTTGGAGCGCGGTTGGGTTTATCTTGGGATGAGAAGGAGACAGGGGAAGGTAGAGCTTTCAAGATATACAGAGCTTTGAAACAGAGACGGTTCTTGTTGTTGCTTGATGATGTCTGGGAAGAGATAGACTTGGACAAGACAGGAGTTCCTCGACCTGACAGGGAAAACAAATGCAAAGTGATGTTCACGACACGGTCCATGGCATTATGCAGCAAAATGGGTGCGGAATGCAAGCTGAGAGTGGATTTTCTTGAGAAGCAATATGCGTGGGAGCTCTTTTGTGGTAAACTTGGGAGAAGAGATCTCTTGGAGTCACCGTTGATTCGCCGGCACGCTGAGACCATTGTCACTAAATGCGGT


Protein sequences

Name Description Sequence
RPS2-like disease resistance protein RPS2-like disease resistance protein [Brassica rapa subsp. oleifera].

LMQSINNELITKGHQYBVLIWVTMSREFGECTIQQAVGARLGLSWDEKETGEGRAFKIYRALKQRRFLLLLDDVWEEIDLDKTGVPRPDRENKCKVMFTTRSMALCSKMGAECKLRVDFLEKQYAWELFCGKLGRRDLLESPLIRRHAETIVTKCG

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-155 NB-ARC,NBS
NB-ARC

LMQSINNELITKGHQYBVLIWVTMSREFGECTIQQAVGARLGLSWDEKETGEGRAFKIYRALKQRRFLLLLDDVWEEIDLDKTGVPRPDRENKCKVMFTTRSMALCSKMGAECKLRVDFLEKQYAWELFCGKLGRRDLLESPLIRRHAETIVTKC

HMMPanther: PTHR23155:SF105
1-82 PTHR23155:SF105,RPS2 (RESISTANT TO P. SYRINGAE 2)

LMQSINNELITKGHQYBVLIWVTMSREFGECTIQQAVGARLGLSWDEKETGEGRAFKIYRALKQRRFLLLLDDVWEEIDLDK

HMMPanther: PTHR23155
1-82 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LMQSINNELITKGHQYBVLIWVTMSREFGECTIQQAVGARLGLSWDEKETGEGRAFKIYRALKQRRFLLLLDDVWEEIDLDK

superfamily: SSF52540
20-156 SSF52540

IWVTMSREFGECTIQQAVGARLGLSWDEKETGEGRAFKIYRALKQRRFLLLLDDVWEEIDLDKTGVPRPDRENKCKVMFTTRSMALCSKMGAECKLRVDFLEKQYAWELFCGKLGRRDLLESPLIRRHAETIVTKCG


List of References

P Tanhuanpää
Identification and mapping of resistance gene analogs and a white rust resistance locus in Brassica rapa ssp. oleifera.
Theor. Appl. Genet.: 2004, 108(6);1039-46
PubMed:15067390 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox