PRGDB00062147 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22218103 (AF315086)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Brassica rapa subsp. oleifera

Comment?

Brassica rapa subsp. oleifera clone RGA-A7 putative disease resistance protein gene, partial cds.

DNA Sequence

CCTCTTAGCTCGTATCAACAACAAATTCGACGAAGAGGTGAGTGAATTTGATGTTGTGATATGGGTTGTGGTCTCTAAAGATTTGCAATACAAGGGCATTCAGGATCAGATTCTACGAAGATTACGTGCTGACCAAGAATTGGAAAAGGAAACAGAAGAGAAGAAAGCATATTCCATAGAGAATATCCTAAGAAGAAAGAAATTCATACTGCTATTAGATGATCTGTGGAGCGCGGTAGATTTGAACAAGATTGGAGTTCCACGTCCAACTCAAGAAAATGGATCGAAGATAGTTTTCACCACTCGTAAAAAGGAAGTTTGCAGACACATGAGAGCTGATGATGAGCTGAAAATTGATTGTTTGTCAACGAACGAAGCGTGGGAACTGTTTCAAAATGTAGTTGGAGAAGCCCCATTAAAGAAGGATTCGGAAATTCTCACTCTTGCAAAAAAAATTTCCGAAAAATGTCAT


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Brassica rapa subsp. oleifera].

LLARINNKFDEEVSEFDVVIWVVVSKDLQYKGIQDQILRRLRADQELEKETEEKKAYSIENILRRKKFILLLDDLWSAVDLNKIGVPRPTQENGSKIVFTTRKKEVCRHMRADDELKIDCLSTNEAWELFQNVVGEAPLKKDSEILTLAKKISEKCH

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-154 SSF52540

LLARINNKFDEEVSEFDVVIWVVVSKDLQYKGIQDQILRRLRADQELEKETEEKKAYSIENILRRKKFILLLDDLWSAVDLNKIGVPRPTQENGSKIVFTTRKKEVCRHMRADDELKIDCLSTNEAWELFQNVVGEAPLKKDSEILTLAKKISE

HMMPanther: PTHR23155:SF115
1-94 PTHR23155:SF115,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LLARINNKFDEEVSEFDVVIWVVVSKDLQYKGIQDQILRRLRADQELEKETEEKKAYSIENILRRKKFILLLDDLWSAVDLNKIGVPRPTQENG

HMMPanther: PTHR23155
1-94 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLARINNKFDEEVSEFDVVIWVVVSKDLQYKGIQDQILRRLRADQELEKETEEKKAYSIENILRRKKFILLLDDLWSAVDLNKIGVPRPTQENG

HMMPfam: PF00931
IPR002182
2-156 NB-ARC,NBS
NB-ARC

LARINNKFDEEVSEFDVVIWVVVSKDLQYKGIQDQILRRLRADQELEKETEEKKAYSIENILRRKKFILLLDDLWSAVDLNKIGVPRPTQENGSKIVFTTRKKEVCRHMRADDELKIDCLSTNEAWELFQNVVGEAPLKKDSEILTLAKKISEKC


List of References

P Tanhuanpää
Identification and mapping of resistance gene analogs and a white rust resistance locus in Brassica rapa ssp. oleifera.
Theor. Appl. Genet.: 2004, 108(6);1039-46
PubMed:15067390 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox